CAZyme Information: MGYG000003765_01639

Basic Information

• Species: Prevotella bergensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella bergensis
• CAZyme ID: MGYG000003765_01639
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847		95277.64	8.1973

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003765	2329044	MAG	Canada	North America

• Gene Location: Start: 260; End: 2803 Strand: +

Full Sequence      

MKRKYLSLLACCFAFSLSAQQHIAPLNEAAWNSSEWISVKDAPVITGKLKEDTRSADGAS
WFNAQITNPQAVAKAIWMTTSLGVNELYVNGQRVGKEILRPGFSHFAKTKYSFTYDITAL
FHTKKGAKNALAAQVTPGWWADKVITPTGLDGFLGKKCAFRGVVQLTFTDGSTQLYGTRT
DTWKAGIAGRVKHAAIFDGEKYDAREKIGYAAKLDRPEVNTEFKGIIKPINGAEIYLRED
LSLQPQRSYIYNKVEGATTDAHGKVVIDREYQQGQTIVLHAGEHLVIDFGQNCAAVPRFE
FHAAKGTTLTCRPGELLNDGNGAKKRGMDGPEGSVHRRNLRIADKSIRMDYIFAGLSSEQ
YQPRYTFFGYRFLDITSTGDVTINRIQSIPVSSISQSMEIGQISTGNALVNRLIQNTLWG
QRSNYLSVPTDCPQRNERLGWTADTQVFSETGTYFANTDRFFHKWTHDLRDTQNEQGGYP
GVAPYGQNGSTSQEYMRVGWADAGIIVPWTVWKQFADRSIVDENWEAMERYMDHVNQTKY
DHNALKNENGNFQWGDWLSYEPLESCGGGAFNKDGVLMPEALEYWCYLSASYWAIDAAMM
RDMAHATGRDSKKYEQMVADAKAYLKERFLTPEGMFKIEILNTMQTPALFALRNHLVEGE
ARNKMIARLRQNFEAHGGCLQTGFLGTSILMKTLTDNGMIDVAYNLLFQHKNPSWLYSVD
NGATTIWERWNSYMKEKGMGPKGMNSFNHYAYGCVCQWIWQTCAGIAADPTQPGFKHIIM
RPMPDRRLGHLDASYQSASGLIKSSWRYEGNQWIWTFTIPQGATASVTLPGDTTTTEYQA
GTYIVKR

Enzyme Prediction     

No EC number prediction in MGYG000003765_01639.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	283	829	3e-142	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.90e-101	399	762	2	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	9.97e-23	71	208	2	134	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	8.99e-17	286	392	9	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.54e-15	765	833	1	67	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT79109.1	0.0	26	847	38	856
CBK67329.1	0.0	26	847	38	856
ANU59244.1	0.0	26	847	38	856
QQR15843.1	0.0	26	847	38	856
QUT31728.1	0.0	26	847	38	856

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	9.33e-106	29	832	285	997	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	7.62e-79	41	831	113	848	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	7.09e-64	26	830	140	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	4.06e-105	29	832	285	997	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	5.72e-98	72	832	187	881	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.37e-97	26	830	141	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	4.24e-45	26	829	141	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000541	0.997025	0.001754	0.000226	0.000218	0.000203

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003765_01639.