CAZyme Information: MGYG000003769_00399

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium
• CAZyme ID: MGYG000003769_00399
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
949	MGYG000003769_3|CGC1	103906.91	4.6995

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003769	4856301	MAG	Canada	North America

• Gene Location: Start: 31585; End: 34434 Strand: +

Full Sequence      

MGKLKHRRAISFITIMLMLVMLLFTNTNATAQSTNEFDSFAAQKEYRLIGYYASWAGYAR
NFGIDKVDYSNLTHLNFAFANLKTDGTVVVGDPWIDCQITSLYPSAGFTWEDQSNNTAGH
FGMLKKIKEKYPNLKTLISIGGWTWSNNFSDVAADPVKRERMANSAVEFILKYGFDGIDI
DWEYPVEGGNNIPHRPSDKQNYVELVKIIRQKLDAQSAKDGNTYLLTIASSANQNYVNNM
DVTEMMKYLDWINLMTYDYHGGFDPQTNHNSPLYLNPNDTTGSIFSIEATVDAYINAGAN
PKDLNLGLPYYGRGWINVNASPENSLFQNGSAATLAGTDLGTWEGSSWDYWDIIDNYIGK
RGYVRYWDDTAKCPYLYSEQTKVFITYDDKESLGYKLDYIKSRNLGGGMFWECSGDKGGE
LLSFTASSLGINNAVVTPTPSITQAPTPTTLPTPTITQAPTPSITQAPTPTPTDNTIEAW
SNTKTYVAGDKVVYNGNIFEAKWWTLGDVPGTAEWGPWKLIGASGKELVSAVVNANYNDA
NSIIDKGSVAVSLNDETIPLWDKSTTYVTGNQVRYNGAVYEAKWWTLGDTPSSIDWGPWK
YIRTVGEVIPTPIPTLSPSPSPSPTPSPIITPSVSPTPIVTVTPAPTVPPSDLPKYVLTG
YWQNFNNGATSLKISDVPSTYQLICVAFAESTSTLGEVTFKLDSGLSTALGGYTEEEFIK
DIAAAKVKGQKVIISVGGEVGTVSVANDTQANIFANSLYKLITKYGFDGVDIDLEHGISA
TYMEKALRSLYDKVGPSLIITMAPQTIDMQSTGYEYFKLALAIKDILTICNTQYYNSGAM
LGYDGKVYSQGTVDFLTALATIQLENGLRPDQVGLGLPASIKGAGGGYVDPSIVTSAFKS
LVTGSKAGNFVAPRTYPSLRGVMTWSINWDAQNNYKFSNAIAACFEELK

Enzyme Prediction     

EC	3.2.1.14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	45	419	2.8e-87	0.9493243243243243
GH18	656	937	1.7e-23	0.9594594594594594
CBM5	478	518	3.9e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	4.92e-143	49	416	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	6.61e-126	47	416	1	334	Glyco_18 domain.
COG3325	ChiA	9.17e-125	45	432	37	439	Chitinase, GH18 family [Carbohydrate transport and metabolism].
cd02871	GH18_chitinase_D-like	1.61e-102	657	943	2	311	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
pfam00704	Glyco_hydro_18	2.53e-98	47	416	1	307	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDU53443.1	2.02e-193	41	943	52	983
QOS39875.1	1.15e-189	25	948	32	915
QAV17876.1	5.59e-167	13	948	24	1084
SDT55294.1	1.02e-162	41	943	51	909
QNU66099.1	6.73e-152	13	440	14	430

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ITX_A	1.98e-117	42	417	8	407	ChainA, Glycosyl Hydrolase [Niallia circulans]
6BT9_A	4.23e-112	35	416	25	448	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
3EBV_A	6.80e-111	655	949	4	295	Crystalstructure of putative Chitinase A from Streptomyces coelicolor. [Streptomyces coelicolor]
6KST_A	4.83e-105	46	429	7	370	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	2.60e-104	46	429	7	370	Crystalstructure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	1.61e-113	42	442	40	467	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P48827	7.20e-71	51	419	43	386	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
A6N6J0	1.21e-70	25	430	18	406	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
P32470	9.55e-70	51	430	43	399	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
E9ERT9	1.36e-69	51	430	44	400	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000911	0.997877	0.000528	0.000274	0.000211	0.000186

TMHMM  Annotations     

start	end
9	31