CAZyme Information: MGYG000003769_00400

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium
• CAZyme ID: MGYG000003769_00400
• CAZy Family: GH18
• CAZyme Description: Chitinase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330	MGYG000003769_3|CGC1	35950.58	4.6128

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003769	4856301	MAG	Canada	North America

• Gene Location: Start: 34797; End: 35789 Strand: +

Full Sequence      

MIHTQDDKKSKGNEIDFNHSGSAVSVICDASKLPTYVLTGYWQNFDNGATCLKISDIPTT
YQLICVSFADSTAIAGEVTFSLNPSLSEALGGYTEEQFIHDIATAKSKGQKVIISIGGEI
GNVSVTNETVANTFANSIYKLIQTFGFQGVDIDLEHGINATYMEKALRLLHSKVGDELII
TTAPQTLDMQSIGYEYFKLSLAIQDILTICNTQFYNSEPMQGHDKKEYSQGTADFITALA
TIQLEHGLRPDQVGLGLPASMKGAGSGYVDPSIVVSAFKCLVTGSQAGDFVPPRTYPGLR
GVMTWSINWDAQNDYKFSNAIAVCFEELKW

Enzyme Prediction     

No EC number prediction in MGYG000003769_00400.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	36	264	3e-22	0.6722972972972973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02871	GH18_chitinase_D-like	1.75e-106	37	320	2	308	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
COG3469	Chi1	8.07e-34	29	319	16	319	Chitinase [Carbohydrate transport and metabolism].
cd02877	GH18_hevamine_XipI_class_III	1.55e-17	101	313	64	271	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
pfam00704	Glyco_hydro_18	9.30e-16	37	310	1	307	Glycosyl hydrolases family 18.
cd00598	GH18_chitinase-like	2.57e-14	40	216	3	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX42168.1	1.60e-137	33	328	255	550
BCJ98159.1	3.85e-133	33	328	255	550
QQQ77696.1	3.17e-123	32	328	196	490
BCY14755.1	3.12e-122	32	321	18	308
AWS41279.1	5.72e-122	18	321	299	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EBV_A	3.39e-107	36	329	5	295	Crystalstructure of putative Chitinase A from Streptomyces coelicolor. [Streptomyces coelicolor]
3N11_A	3.89e-54	30	328	1	329	Crystalstricture of wild-type chitinase from Bacillus cereus NCTU2 [Bacillus cereus],3N12_A Crystal stricture of chitinase in complex with zinc atoms from Bacillus cereus NCTU2 [Bacillus cereus]
3N15_A	1.08e-53	30	328	1	329	Crystalstricture of E145Q chitinase in complex with NAG from Bacillus cereus NCTU2 [Bacillus cereus]
3N17_A	4.25e-53	30	328	1	329	Crystalstricture of E145Q/Y227F chitinase in complex with NAG from Bacillus cereus NCTU2 [Bacillus cereus]
5KZ6_A	4.59e-53	30	328	4	332	1.25Angstrom Crystal Structure of Chitinase from Bacillus anthracis. [Bacillus anthracis],5KZ6_B 1.25 Angstrom Crystal Structure of Chitinase from Bacillus anthracis. [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27050	2.55e-54	38	320	192	506	Chitinase D OS=Niallia circulans OX=1397 GN=chiD PE=1 SV=4
Q05638	9.21e-47	30	317	258	588	Exochitinase 1 OS=Streptomyces olivaceoviridis OX=1921 GN=chi01 PE=1 SV=1
D4AVJ0	1.01e-40	54	319	17	322	Probable class II chitinase ARB_00204 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00204 PE=1 SV=2
A5FB63	1.81e-27	33	325	1139	1480	Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=chiA PE=1 SV=1
Q838S2	7.02e-22	20	328	28	346	Chitinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0361 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003769_00400.