CAZyme Information: MGYG000003769_00916

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium
• CAZyme ID: MGYG000003769_00916
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000003769_6|CGC2	37868.07	5.2073

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003769	4856301	MAG	Canada	North America

• Gene Location: Start: 91390; End: 92346 Strand: +

Full Sequence      

MLKEKYKDFFKVGVAVSDKTIESHDAIIKEHFNSITCENEMKYSSVTEQEGIYDFKKADK
IVEFAKENNLLVRGHTFAWHNQTPDWVFEGSKEQLLNRIKNHITILGERYKEQVFCWDVV
NEAIEDKTGLVMRQSKWVETLGENFMDIIFHMAKEQLPDTELFYNDYNECNLEKREKIIQ
VIKGMKERGVPIDGVGLQCHHNIYFPSEDDLRRTIETYASLNMRIHITEMDVSLFEYNDH
TRLLKPSDILLEKQAKAYETAFRIFREYKDYIDCVTLWGVADDVTWLDNFPVRNRKNWPM
LFDEEHKPKEAFYRILDF

Enzyme Prediction     

No EC number prediction in MGYG000003769_00916.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	2	317	5.2e-106	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	7.13e-117	2	317	1	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	3.22e-111	41	315	1	263	Glycosyl hydrolase family 10.
COG3693	XynA	6.40e-88	29	318	55	340	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX43367.1	7.90e-133	2	318	4	321
QIK52226.1	7.03e-126	2	317	10	334
SQI53962.1	5.03e-125	2	318	7	325
AFE82288.1	1.34e-123	2	318	11	329
ACW01951.1	3.42e-123	2	318	13	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Q8X_A	3.75e-120	2	316	8	329	Thehigh-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],2Q8X_B The high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],3MSD_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSD_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
1N82_A	5.32e-120	2	316	8	329	Thehigh-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],1N82_B The high-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],3MUA_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUA_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
4L4O_A	2.43e-119	2	318	13	337	Thecrystal structure of CbXyn10B in native form [Caldicellulosiruptor bescii DSM 6725]
3MS8_A	3.05e-119	2	316	8	329	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MS8_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MUI_A	4.33e-119	2	316	8	329	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUI_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23556	2.79e-117	2	318	17	342	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynA PE=1 SV=1
O69231	3.25e-116	2	316	8	329	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P45703	4.04e-109	2	317	8	329	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
Q12603	3.80e-102	2	318	35	352	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1
P10474	3.27e-79	4	317	47	371	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003769_00916.