CAZyme Information: MGYG000003769_01400

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium
• CAZyme ID: MGYG000003769_01400
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	MGYG000003769_11|CGC1	52740.28	4.8806

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003769	4856301	MAG	Canada	North America

• Gene Location: Start: 4773; End: 6170 Strand: +

Full Sequence      

MQYKNKKVSDIKIAYIGGGSRGWAWRLMADLAMESAISGTISLYDIDKEAAKHNEIIGNR
LTEREDTVGEWKYETAEDLKDALTGADFVIISILPGTFDEMAIDVHEPEKYNLWQSVGDT
AGPGGLVRALRTIPMYTVIAEAIKEYSPDAWVINYTNPMSLCVKTLYRVFPQIKAFGCCH
EVFGTQKLLKNISEEMLELTDIQRNEIHVNVLGINHFTWFNEASYQGIDLFPVYKAYIDK
HFEDGFIKDEEHWMNASFETKNRVKFDLFRRYGLIAAAGDRHLAEFMPGDEYLKDPETVA
SWGFKLTTVDSRKDDLKKRLEKSERLVKNEDEIELKPSGEEGVQLIKALCGLDRIVSNVN
IPNTGGQIPNLPKTAIVETNAVFSRDSIKPLIAGELPEDILNLILPHVENHEDILDAAIE
RSFDKALKAFLNDPLVKAKCNKEDAEILLKDMIKKTSTYLPKEWI

Enzyme Prediction     

No EC number prediction in MGYG000003769_01400.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	12	191	9.7e-57	0.9832402234636871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	1.85e-165	11	453	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	8.33e-107	11	462	4	438	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	9.78e-76	12	461	3	428	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	2.46e-58	12	189	1	177	Family 4 glycosyl hydrolase.
cd05197	GH4_glycoside_hydrolases	5.29e-54	11	453	1	423	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ94352.1	5.44e-247	1	464	1	464
BCJ92570.1	3.92e-245	1	464	1	464
ABX43749.1	1.07e-241	1	464	1	464
QIX89596.1	1.37e-237	1	464	1	465
QRP39116.1	5.55e-237	1	464	1	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	5.87e-154	8	453	3	436	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	2.56e-26	11	461	5	435	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1U8X_X	1.99e-25	5	461	23	462	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]
1S6Y_A	5.53e-25	11	461	8	438	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1OBB_A	1.53e-22	11	438	4	453	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9KTB9	2.14e-242	1	464	1	464	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
I3VRU1	4.86e-203	1	460	1	458	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	3.77e-180	1	464	1	453	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
P39130	1.14e-157	8	453	7	440	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
O34645	2.14e-50	12	461	3	429	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003769_01400.