CAZyme Information: MGYG000003769_02476

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium
• CAZyme ID: MGYG000003769_02476
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000003769_24|CGC1	43904.08	4.5872

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003769	4856301	MAG	Canada	North America

• Gene Location: Start: 4192; End: 5319 Strand: +

Full Sequence      

MDMIVKYIDELLEKSTPERPMWNIEKLKSGAKSEWNYIDGCMIKAILEMYSITKEEKYLA
FADAFIDYRVNEDGTIAGYSVEKYNIDDVNAGKTLFELYDLTGKEKYRKAIDLVYSQVQT
QPRTKEGNFWHKLIYPNQIWLDGLYMGQPFYMEYETRFNNKENYKDIFNQFFNVYELLRD
KETGLYFHAYDSSREMFWCDKETGLSKNFWLRALGWYTMALLDTLDKCDPVGYEEEYEKL
KKIFAELMESMLKFQDESGMWYQVVNMGGREKNYLETSGSAIMAYALLKGVRLNFLPESY
RQYGEKAMTGICDRYLNTEEGKMSLGGICLVAGLGGPDMRDGTYEYYMSEPIVQDDAKGV
GPFLLAYTELLRINK

Enzyme Prediction     

No EC number prediction in MGYG000003769_02476.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	28	372	1e-118	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.03e-98	23	372	22	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.84e-87	34	372	26	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX40590.1	1.30e-245	1	375	1	375
CBL09353.1	5.62e-217	1	373	1	373
VCV21981.1	1.13e-216	1	373	1	373
CBL12002.1	6.54e-216	1	373	1	373
AEN96572.1	3.29e-212	1	372	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.90e-109	35	369	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	6.48e-67	22	370	28	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.73e-66	22	370	18	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	1.24e-13	35	311	65	328	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	5.58e-12	35	311	66	329	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.55e-66	22	370	28	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	6.81e-41	146	371	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	6.81e-41	146	371	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	5.17e-22	35	324	29	297	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003769_02476.