CAZyme Information: MGYG000003771_01419

Basic Information

• Species: Blautia sp002161285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp002161285
• CAZyme ID: MGYG000003771_01419
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305	MGYG000003771_46|CGC1	35577.36	9.9246

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003771	3602220	MAG	Canada	North America

• Gene Location: Start: 6281; End: 7198 Strand: +

Full Sequence      

MSVTVIIPTYKPGDKFLRLMEGLKKQTLPPDKILIMNTEKKFWKDSVLRGMEQAEVIHIS
KEEFDHGRTRAQAAEMADSEFLIYFTQDAVPADTCTIENLLKPFRDPEVGAVYGRQLPDK
DCRLIERYTRSFNYPEKSRRKTRKDIPILGIKTFFCSNVCAAYRKEAYEKMGGFTFPTIF
NEDMIMAGNLIKAGYAVFYAADAQVIHSHNYTWIQQFKRNFDLAVSQADHPEIFKDVPSE
GEGIRLVKSTCFYLIKKGRPWLFPQLVFSSAFKFLGYRMGKNYRKLPRRLVMKFTMNPDY
WKKKN

Enzyme Prediction     

No EC number prediction in MGYG000003771_01419.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	171	9.1e-17	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13641	Glyco_tranf_2_3	2.18e-13	3	221	4	225	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
COG1215	BcsA	1.01e-12	3	205	56	262	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam00535	Glycos_transf_2	2.26e-12	4	168	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	4.98e-10	1	212	3	224	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06423	CESA_like	1.06e-09	5	185	1	177	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY99516.1	1.29e-145	1	303	1	303
QJU13078.1	4.02e-143	2	301	5	304
ANU76706.1	6.63e-142	2	301	5	304
QQQ94283.1	6.63e-142	2	301	5	304
ASU29511.1	6.63e-142	2	301	5	304

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	6.18e-75	1	301	1	302	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003771_01419.