CAZyme Information: MGYG000003773_00419

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11
• CAZyme ID: MGYG000003773_00419
• CAZy Family: CBM40
• CAZyme Description: Sialidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771	MGYG000003773_11|CGC1	86331.96	6.3982

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003773	3076411	MAG	Canada	North America

• Gene Location: Start: 30531; End: 32846 Strand: +

Full Sequence      

MSQFPAPVFEIENLCNISVQAPDLTAQLKPYTNLEEGTVIIRFRNYELHSGGAALLTFVN
NQYPASYFSIYIVVASMVGFVKKVISRDHSEFHTIIVNADEQAQVNMINTLAVRIKAGEG
YRIYLNGHLIREMPDPNACFLRDISLRGSIDTILAGKMVDAQKMKQREMLFHGDIDFIRL
YDTPLEHELLCAFTGQTASDYRVRIPEEGRLTPPVKLCASGYQGAGNFRIPVPLRTLKGT
LLVAFDKMFHGPQDHPNRIQLVMRRSEDGGRTWKHAQTLVRFPGNAQAIDSCMVQDRDTG
RIFLLTSTYPENVTVFTSDSGVGYVKENNAVKRILVDDAARRYLVQPDGTVTLDGIPTGF
TARRNGTELYRDGHLVGYTYMEKCPLRVPLTSFLLMLTSDDDGKTWSEPIDLNPLLKKDW
MHFWGCGPGTGIQLKRGAHKGRLLMQTYCFNKHSIESPMFIYSDDHGATWHMGETINDHR
LYDGKTYSAETADNWDLDSSESQGVELPNGTVLLFAKNYRNPTRCIAVATSLDGGETFEP
AVRHDPALHSTYSMSVIEWPVPIDGRTAYFYASSDSWAGNYNGAIKTGFFCDDGHGGHIE
WRHSRLFKPGTFGYCFLCPVTENTLGVAYESSGALHLSFQTMDIPFLLAPDDTPLNPVKL
LDVQLRANDQGTLITLVFDQLIMLTGERIVYALCGEEWRAASYAGRRNDSRSYDFQLDAA
SPSSILRIALSEKADIVSGNGMLYHFDRASGTLLWQYYNRPYISLKGSGAV

Enzyme Prediction     

No EC number prediction in MGYG000003773_00419.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	219	639	1.1e-75	0.9327485380116959
CBM40	19	191	1.2e-22	0.9050279329608939

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	6.83e-64	215	633	1	326	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.65e-12	391	560	79	274	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	3.30e-12	228	569	275	639	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam02973	Sialidase	4.24e-08	24	197	20	188	Sialidase, N-terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA44916.1	1.48e-113	34	716	219	900
AYE33273.1	1.60e-112	34	716	219	904
QAS61444.1	1.60e-112	34	716	219	904
APZ74275.1	4.50e-110	18	647	20	647
BAB80431.1	6.81e-110	18	647	61	688

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TSP_A	5.59e-85	212	647	8	447	Crystalstructure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124],5TSP_B Crystal structure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124]
2BF6_A	7.77e-85	212	647	7	446	AtomicResolution Structure of the bacterial sialidase NanI from Clostridium perfringens in complex with alpha-Sialic Acid (Neu5Ac). [Clostridium perfringens]
2VK5_A	8.46e-85	212	647	7	446	TheStructure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK6_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_B The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens]
3H72_A	1.19e-67	205	647	1	473	Crystalstructure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H72_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H73_A Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6],3H73_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6]
7A54_A	2.77e-67	205	647	24	496	ChainA, Sialidase A [Streptococcus pneumoniae],7A54_B Chain B, Sialidase A [Streptococcus pneumoniae],7A5X_A Chain A, Sialidase A [Streptococcus pneumoniae],7A5X_B Chain B, Sialidase A [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29767	2.95e-114	34	716	219	900	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
P62576	2.22e-64	199	647	311	789	Sialidase A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=nanA PE=1 SV=1
P62575	2.22e-64	199	647	311	789	Sialidase A OS=Streptococcus pneumoniae OX=1313 GN=nanA PE=1 SV=1
Q27701	5.30e-44	23	637	103	741	Anhydrosialidase OS=Macrobdella decora OX=6405 PE=1 SV=1
Q02834	1.29e-25	217	680	56	430	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003773_00419.