CAZyme Information: MGYG000003774_00587

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas_A
• CAZyme ID: MGYG000003774_00587
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	MGYG000003774_101|CGC1	38068.15	9.4331

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003774	1422402	MAG	Canada	North America

• Gene Location: Start: 1512; End: 2516 Strand: +

Full Sequence      

MTRKVLVLLFPLLLLTGCGSTRNAANQQVSRMPMPGKNPSYNAYIRQYAPAALQSQREFG
IPASITMAQGLLESGAGGSALAQKSNNHFGIKCHNGWSGARTYHRDDNPRDCFRVYDDPL
DSYLDHGQFLTGNRRYSSLFRIDMADYKSWAKGLQSAGYATDRGYANKLIKIIEDYQLYL
LVDGNVERDYAYNRPEQPRRTVSSKPPMRYEKPASRETTPAGVREIYKSYGLLYVLAKKE
DDLASIARDLDISEKKLTDYNDFPPGYPIEQGDIIYLQRKLRRADPPYYRHEVRVGESIH
GIAQRYGIQLRSLYQMNKLDPAYIPQEGDVLILR

Enzyme Prediction     

No EC number prediction in MGYG000003774_00587.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	49	178	3.7e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	4.58e-39	43	179	162	309	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	3.23e-38	43	185	45	191	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	1.11e-27	49	178	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK05684	flgJ	7.24e-24	20	173	123	294	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	5.29e-23	40	176	7	139	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ04699.1	1.06e-107	16	334	22	331
BBK92151.1	5.65e-98	37	334	27	302
QUR47394.1	5.65e-98	37	334	27	302
QIX64041.1	5.65e-98	37	334	27	302
CEA15157.1	6.12e-98	40	334	35	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	1.20e-12	43	173	3	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.44e-12	43	173	4	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	9.40e-12	43	173	4	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN4_A	2.31e-10	50	193	13	162	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	3.26e-10	50	174	13	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9X9J3	5.89e-12	35	172	154	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P58231	9.02e-11	34	193	145	308	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	9.02e-11	34	193	145	308	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
O32083	2.35e-10	64	178	71	194	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9I4P4	1.03e-09	20	182	212	391	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000060	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003774_00587.