CAZyme Information: MGYG000003774_00850

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas_A
• CAZyme ID: MGYG000003774_00850
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		33253.23	6.0856

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003774	1422402	MAG	Canada	North America

• Gene Location: Start: 2126; End: 3061 Strand: -

Full Sequence      

MGNREGVRYGRLTDASGQSGLVICANGGSMSVLPYSQMQLAMAPHPYQLPQSDGTYVHMD
RAVTGLGGNSCGQGGPLTEDRVMGGPHTMTLQLRPLGATGVVATPTALPVTMQRSGTGLV
TLSGSSPIRYSVDGKPAVRYERPFDLREGGVVRAWPEGSDWIATEHRYERITTIPVTISG
VSSEESGEGSVAHLLDGDPSTIWHSMYSVTVAAYPHWVALDCGEERSIAGVTYLPRQDGS
TNGDIRDYALSISSDGETWQEVARGTMERSKSKQTLRLAHPVKARYVRFTALSSQSGADF
ASGAELMVLSE

Enzyme Prediction     

No EC number prediction in MGYG000003774_00850.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	182	307	1.6e-26	0.9112903225806451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00754	F5_F8_type_C	2.25e-30	182	306	5	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam02929	Bgal_small_N	1.92e-22	1	93	139	230	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.
smart01038	Bgal_small_N	1.76e-18	1	88	180	267	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.
cd00057	FA58C	2.21e-14	181	298	16	135	Substituted updates: Jan 31, 2002
PRK10340	ebgA	4.68e-08	2	73	907	978	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VTR31950.1	4.69e-95	1	311	1032	1349
QRY57876.1	2.32e-94	1	311	1031	1348
QMV69371.1	8.35e-94	1	311	1031	1348
QQT52765.1	1.15e-93	1	311	1031	1348
QRO23809.1	1.15e-93	1	311	1028	1348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BER_A	3.15e-18	176	308	463	597	Y370GActive Site Mutant of the Sialidase from Micromonospora viridifaciens in complex with beta-Neu5Ac (sialic acid). [Micromonospora viridifaciens]
1W8N_A	3.15e-18	176	308	463	597	Contributionof the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens. [Micromonospora viridifaciens],1W8O_A Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens [Micromonospora viridifaciens]
1WCQ_A	3.15e-18	176	308	463	597	Mutagenesisof the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_B Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_C Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens]
2BZD_A	3.15e-18	176	308	463	597	Galactoserecognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_B Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_C Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens]
1EUT_A	3.17e-18	176	308	467	601	Sialidase,Large 68kd Form, Complexed With Galactose [Micromonospora viridifaciens],1EUU_A Sialidase Or Neuraminidase, Large 68kd Form [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02834	1.80e-17	176	308	509	643	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
Q0TR53	2.04e-13	176	308	629	765	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	2.04e-13	176	308	629	765	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P0CS93	8.62e-10	195	308	72	186	Galactose oxidase OS=Gibberella zeae OX=5518 GN=GAOA PE=1 SV=1
I1S2N3	1.15e-09	195	308	72	186	Galactose oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GAOA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003774_00850.