CAZyme Information: MGYG000003774_01127

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas_A
• CAZyme ID: MGYG000003774_01127
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290		32931.24	8.6559

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003774	1422402	MAG	Canada	North America

• Gene Location: Start: 987; End: 1859 Strand: -

Full Sequence      

MVICVDYGSFCMRYILPFVRKQLPTTRIVYFIPPKVWAWKEFRVHQLRRDCDLIQCIFPF
EVPYFRSKGVDRVSYIGNPTYEEVMHFRSHRSADVTLGERPYIALLSGSRTSEVRRNLPL
MLESVAPLGDRYRLMIAGVSAIDRSLYSEIIERYSLQRVEVRYGETYEILSGADAALVTS
GTATLETALLGTPQVVCYATRAGRLVNFAFDHFFKVPYISLVNLIARREVVAELFGARCS
VKAIRSHLTPLLSDTAERRAMLEAYDAVSEALRTELPASTLAAREIVALL

Enzyme Prediction     

No EC number prediction in MGYG000003774_01127.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	1	273	2e-71	0.7570621468926554

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	3.33e-72	1	290	88	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	1.97e-66	2	290	89	375	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	3.08e-54	1	258	85	345	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.67e-43	19	289	107	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.82e-37	1	225	79	286	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ02201.1	1.60e-84	1	290	87	372
ATS09476.1	9.93e-71	1	288	88	371
QUI91423.1	1.40e-70	1	288	88	371
QUI89478.1	1.40e-70	1	288	88	371
AIJ35071.1	1.98e-70	1	288	88	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.12e-21	27	273	116	366	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.12e-21	27	273	116	366	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0KSB2	2.81e-36	27	290	113	372	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain GB-1) OX=76869 GN=lpxB PE=3 SV=1
Q88MG7	7.64e-36	27	290	113	372	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=lpxB PE=3 SV=1
Q3JAC1	9.52e-36	1	272	92	362	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1
Q5X5J5	1.26e-35	1	272	91	362	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila (strain Paris) OX=297246 GN=lpxB1 PE=3 SV=1
A5W837	2.08e-35	27	290	113	372	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003774_01127.