CAZyme Information: MGYG000003777_00006

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes
• CAZyme ID: MGYG000003777_00006
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000003777_1|CGC1	55112.32	4.9992

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003777	2405889	MAG	Canada	North America

• Gene Location: Start: 6416; End: 7840 Strand: +

Full Sequence      

MGFQKDFLWGGATAANQCEGSIFEDGRGLANVDVCPAGKDRNAVITGHKKMLEMDKEHVY
PAVEAVDFYHHFREDIRLFAEMGFRVYRMSIAWTRIFPNGDEEEPNEEGLKFYEEVFREC
QKYQIQPLVTISHFDCPIHLIRKYGGWRSREMIDFYLHLCEVLFTRFKEYVNLWLTFNEI
NMILHAPFMGAGIYFEEGENEEQIKYQAAHHELVASALAVRMAHEINPANKVGCMFAAGS
AYPYTCKPEDVWEAMLVDQENFFFTDVQARGYYPAYAVKRLQKKGVFPEMEPGDEEILRR
HPVDFISFSYYNSRCIAAPGNVQEEAEGNLFKSAKNPYLKFSEWGWPIDPLGLRITLNQV
YDRYQKPLFIVENGLGAADTPNERGEIEDDYRIDYLREHIRAMRDAVEEDGVELMGYTTW
APVDLVSAGSGEMRKRYGFIYVDKQDDGSGTRRRIRKKSFYWYQRVIQTNGEEL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	471	1.8e-142	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	474	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	474	4	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	5	474	8	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	473	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	474	4	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCD37309.1	6.60e-312	1	474	1	474
QMW69893.1	6.60e-312	1	474	1	474
AQM59030.1	2.75e-267	1	474	1	473
AIY84022.1	3.91e-267	1	474	1	473
AXU47682.1	3.32e-266	1	474	1	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	3.64e-199	3	474	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	4.79e-175	5	474	10	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	3.26e-168	5	474	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	9.28e-168	5	474	9	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
4IPL_A	8.87e-165	3	474	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	8.11e-216	3	474	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	1.32e-196	3	474	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	1.60e-181	1	474	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q46829	2.62e-174	5	474	10	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q48409	9.63e-171	3	474	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003777_00006.