CAZyme Information: MGYG000003777_00043

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes
• CAZyme ID: MGYG000003777_00043
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
815		95444.44	5.3497

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003777	2405889	MAG	Canada	North America

• Gene Location: Start: 49074; End: 51521 Strand: +

Full Sequence      

MQYQELHDGWKMHRAGDEKWIHAIVPGSVYTDLLRAGKMEDPFWKDNENQAWALMDYDYE
YETCFDADQTLFENSRILLRFDGIDTIADIFLNEQKIGSAENMHRIWEYDVTGTLKRGKN
RLRVLLHSPNQYVRDAFSNCRTLGSEDAMDGFVHIRKAHCMFGWDWGAHLPDAGIFRRVS
LIGIDKARLEDVYVVQHHTDGKVELEVRVKVEETEKTGYEIRTSLFSPAGELLGRQHDGG
RITIENPQLWWPNGYGEQPLYTVRVELLSEGKTRDTWEKRIGLRTMTMHREKDEWGESFA
HEVNGICIFAMGADYIPEDHLIGRTTPERTRQLLMDSRAANFNTIRVWGGGYYPEDWFFD
LCDELGLIVWQDFMFACAVYELTPHFKENIRREFIDNVKRIRHHACLGLWCGNNEMEQFV
SEKHHWVTKPSEVRDYIIMYEQLIPEVLAEYDPQTFYWPASPSSGGSFDEPNDPDRGDVH
YWQVWHGNKPFSEYRKYFFRYASEFGFQSFPCRKTIETFTDDEGDCNPFSYIMEKHQRNY
GANGKIMNYMQQTFLYPTSFDSFLYASQLLAGQAVRYGVEHFRRNRGRCMGAIYWQLNDC
WPVVSWSSIDYTGRWKALHYFAKRFFAPVMISCQEEGMMTQEADMNREHFVFEKSIRLNV
ANETRKEQKGTVLWEVRDAKGNILRSESREVTVPPLSSLWLDKVLLKEADPFREYVSYRF
EQEGEIVSEGTVLFSYPKYFRYEDPKLTYSVEGDEIVVNAAAYAAGVEISNAKENLVLSD
NYFDMNPGEKRVKIIRGDAQEIRLRSINSSISIRP

Enzyme Prediction     

No EC number prediction in MGYG000003777_00043.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	736	1.8e-106	0.7420212765957447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.85e-102	1	632	10	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	3.01e-17	656	739	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10150	PRK10150	4.76e-16	58	285	66	277	beta-D-glucuronidase; Provisional
pfam00703	Glyco_hydro_2	9.88e-16	187	284	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	4.16e-15	61	415	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE97789.1	0.0	4	807	18	833
QIB54534.1	0.0	4	807	4	819
QMW79049.1	0.0	4	807	4	819
QJU13790.1	0.0	4	807	4	819
QQQ93614.1	0.0	4	807	4	819

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	3.87e-157	6	806	8	843	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	3.98e-157	6	806	8	843	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	2.84e-156	6	806	6	841	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	2.92e-156	6	806	8	843	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
7OP6_A	2.82e-153	6	813	13	842	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CGA8	1.48e-118	1	797	4	830	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q5B7W2	1.63e-115	6	797	9	828	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q4WAH4	2.50e-114	1	797	4	830	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	9.57e-114	1	797	4	830	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A1D911	1.87e-113	1	797	4	830	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003777_00043.