CAZyme Information: MGYG000003777_00124

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes
• CAZyme ID: MGYG000003777_00124
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781	MGYG000003777_1|CGC4	86759.68	7.1345

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003777	2405889	MAG	Canada	North America

• Gene Location: Start: 143073; End: 145418 Strand: +

Full Sequence      

MKALDFNEGWTFCKEGVTSPQQVTLPHDAMLFKGRKPDNPSGGACACFGGGVYRYEKIVH
APKEWQGCAVQLYFEGAYMKSTVLLNGKTVGGCTYGYSAFLVTLDGLRYGEENLITVIVE
NDKMPNSRWYTGSGIYRPVHLLIGKKEHIRWQGVKINTLSCSPAKIRVQTNHTGGDVEVE
ILYGKKAVAAAKGEDVEVQIPDAKLWSADTPNLYQCRVTLKDGGEIQDQVTEDFGIRMIE
YSNKGLFINGKETLLKGGCVHHDNGILGAKTFAESEWRRVRILKESGYNAIRSSHNPCAI
EMMKACDYYGIYIMDETWDMWYSHKNKYDYASDFMEGYRFDLKSMVEKDYNHPSVIMYSI
GNEVSEPATKKGGKLAKEMVEYLHQMDQSRPVTGGFNLMIMAKAAEGKGIYKEEGGRDNK
TEKQMNSSMMFNVITSMVGSGMNKAGNSKKVDAVTSPALDTLDIAGYNYASGRYPLEAKC
HPDRVIFGSETFPKEIAKNWKMVESYPYLIGDFMWTSWDYLGEAGSGAWGYTSDSVGFEK
PYPWILAEMGALDILGNPNGQLFWAQAVWKALKAPVIAAQPVNHPGKRPAKSAWRGTNAL
PTWSWKGCTGNKAVVEVYYDAAKVDLFLDNRKVGSKAFKDCRAVFKMKYTPGTLKAVAYD
AAGNVIGQNQLVSAKENLIVRILPEKEQASPGEILYISVQVTDEDGNVESNADRRLEAEV
KGGELLGFGSANPRTEESYVQGAYTTHYGYAQAVVRAGNERDVTVIIHDGKEVYEKKIPI
L

Enzyme Prediction     

No EC number prediction in MGYG000003777_00124.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	582	8.6e-99	0.6156914893617021

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.25e-61	3	393	27	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	2.20e-39	55	393	69	446	beta-D-glucuronidase; Provisional
PRK10340	ebgA	7.65e-29	55	392	113	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	9.51e-27	55	392	124	485	beta-galactosidase.
pfam02836	Glyco_hydro_2_C	8.36e-21	239	393	1	159	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFN84582.1	4.86e-316	1	770	1	759
AEE97750.1	1.08e-304	1	780	1	782
QTL78998.1	6.20e-251	1	756	1	776
AHF23998.1	1.50e-240	1	756	23	806
CBK92219.1	1.28e-232	1	780	1	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RSK_A	1.40e-116	1	758	5	753	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6B6L_A	2.55e-116	1	758	5	753	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7CWD_A	7.37e-92	1	772	1	790	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	6.71e-89	2	757	8	782	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
5T98_A	1.17e-87	4	761	28	798	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	2.62e-81	5	756	46	822	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	7.89e-60	5	722	50	758	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	2.80e-29	71	390	123	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q56307	4.83e-28	36	366	106	444	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P77989	1.10e-26	4	395	6	414	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003777_00124.