CAZyme Information: MGYG000003777_00794

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes
• CAZyme ID: MGYG000003777_00794
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
766	MGYG000003777_6|CGC1	84461.7	4.6204

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003777	2405889	MAG	Canada	North America

• Gene Location: Start: 74261; End: 76561 Strand: -

Full Sequence      

MEKQNLKELIAQMTLEEKAGLCSGADFWHTKAVERLGIPAVMVSDGPHGLRKQDDEADHL
GVNDSIKAVCFPAGCATASSFSRQTVKSLGETIGTECQAEGVSTVLGPAMNIKRSPLCGR
NFEYYSEDPFLSTEIAGALVHGVQSKNVGTSPKHFMANNQEYHRMTSSSEMDERTMREIY
LASFEGMVRKEKPWTIMNSYNRLNGTYLCENKEMLTDILRNEWGFDGYVMTDWGAMNDRV
TALKAGCDLEMPASNGITDAEIVEAVREGTLSEEILDQACERILNIVYRFEENRDKEAVF
DLEKDHETARKIEEECIVLLKNEDAILPLKKDVKAAFIGKYAEAPRYQGGGSSHINSFKV
ESALDAVKTREAGCGTDAANVVYAKGFDDAKDETDEALLKEAVEAAKNADTAVIFAGLPD
SFESEGYDRKHMRLPDCQNRLIQAVAEVQPNTVVVLHNGSPVEMPWISQVKAVVEAYLGG
QAVGGAVVNVLYGDVNPSGRLAETFPLRLEDTPCYLTYGGEHDKSVYSEGVFVGYRYYVS
KDMKVLFPFGHGLSYTTFEYSNLVLDQKEMKESKELKVSVDVTNTGACAGKEVVQLYVSA
KESAMKRPVRELRGFDKVELQPGETKTVSFTLDRRAFAYWSVQIHDWHVESGAYEIQIGK
SAQEIILTETVQVESETVIPKVFTMNSTMGEIMADPKGKMILEQAMGAMGGGAAQAMAED
AQDESGAISNEMIAAMMEGMPLRQILSFVPGVKKEMLQQLIQALNA

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	252	8.1e-70	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.27e-103	8	665	40	757	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	8.96e-76	317	535	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
COG1472	BglX	1.86e-66	26	359	48	377	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.54e-63	3	633	50	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.32e-37	35	286	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30267.1	0.0	1	765	1	762
QHQ63232.1	0.0	1	765	1	754
QUI21624.1	0.0	6	765	2	754
QUC66582.1	0.0	5	765	2	753
QTE73764.1	0.0	1	765	1	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.55e-293	5	765	4	752	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.06e-195	4	702	3	691	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	9.92e-140	1	676	1	839	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	5.29e-135	3	676	3	839	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	1.02e-131	1	676	1	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.20e-292	5	765	4	752	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	6.92e-192	10	745	9	733	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.10e-190	10	745	9	733	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
Q0CAF5	7.79e-145	1	674	1	831	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
A1CA51	9.79e-142	1	666	1	823	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003777_00794.