CAZyme Information: MGYG000003781_00349

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; JABCPO02
• CAZyme ID: MGYG000003781_00349
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
920		103540.07	9.6382

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003781	976696	MAG	Canada	North America

• Gene Location: Start: 10016; End: 12778 Strand: +

Full Sequence      

MNNYNDKEERDRRRKERQERIAKRAEKMQKYQEGVTNTVYNSNRDYSDMHVNPLRTNDAD
YNYLKGNGQYSNESVKDLEMSKKRYNRSRVNEKKNNKQNNKKINSKKNNNAKKKKGKLRK
FIDIILILILLGIAMIAYVFFSVGKEYRVSNEDLLLKNQNTEVFDSEGTQIATLSLDEKR
KVMKLSEMSEFIPNAFIAIEDQRFYNHRGIDPKRTIGAVANYVIKRGSSSYGGSTITQQL
VKNMTKDDERNWKRKVREMVRARQIEDLLSKDEIMELYLNLIYVGGNNIHGIALGSDYYF
SKNPKDITLEEAAYMAGINHIPANYNPFITKKDDESEEDFNKRKEAVDTRIKTRIKTVLG
KMLELGKITKEQYDEAVAKTEKGLEFKQGSLAQSTVKYSYIVDAAIQESIDALVDVKNMS
PDVAEKKIYSGGYKIYTTQKTDLQNIAEEEMKKDRYIKKSRKNKGKHSQAAAIFVDNETG
AVVSAVGGLGEEGVKITRGDWNRVTRTKRQMGSSMKPIAVVCPGLESGKLTAASTFNDAP
FKIGSWDPKNYTRRFKGWMTIREAIKLSQNIPNIKALQQIGIETSYNYLKSVGIPVVEQD
KTLGALALGGLTQGATVTNAVGAYQAIANNGEYIKPHFVTKLENQKGEEIYKPNIEAKRV
LSKQNAFIAQDILLTVVRPGGTAPYCSISGVDVGAKTGTSNDDVDRWLCGFSPKYTGAVW
YGFDEAEEVYFSGNPAGQIFSAILKKYHKDNKNLRFEKPDGIVEVNVCNVSGKLPTGSCS
SDARGSRVYKEYFVKGTEPTEKCDKHITAEICTIDGLLATEDTLPENRATRGFIDQPEGG
TEDSAYRKPTSYSNAPGKKAKEEAEAKAKAEAEAKAKEEEEKRKREQQEQEERNKKPEDN
KKPGAGDGGKPPENPKKPEN

Enzyme Prediction     

No EC number prediction in MGYG000003781_00349.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	168	344	1.1e-54	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	7.54e-157	179	750	1	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.01e-154	137	772	32	623	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	9.99e-131	161	807	49	772	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	9.61e-77	171	788	136	717	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	4.11e-74	161	781	37	594	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABP66127.1	7.49e-138	158	854	72	764
QCX34227.1	8.02e-136	142	834	44	738
AZT91374.1	9.95e-136	158	821	72	723
AEM74911.1	3.72e-135	158	821	65	716
ACM61713.1	4.81e-135	118	852	18	753

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	4.81e-80	159	856	19	865	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG8_B	6.84e-62	263	758	1	465	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
4OON_A	1.25e-60	163	773	23	748	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
2JE5_A	9.51e-60	161	775	35	665	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]
3ZG7_B	8.49e-58	263	758	1	465	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5I6G4	2.06e-115	118	823	17	719	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	2.06e-115	118	823	17	719	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A7GHV1	3.73e-115	118	823	17	719	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
Q0TNZ8	2.00e-99	117	811	23	729	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
Q891X1	1.61e-98	152	806	52	713	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
121	143