CAZyme Information: MGYG000003786_00519

Basic Information

• Species: Stomatobaculum naviforme
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Stomatobaculum; Stomatobaculum naviforme
• CAZyme ID: MGYG000003786_00519
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000003786_5|CGC3	39795.59	10.0037

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003786	2066306	MAG	Canada	North America

• Gene Location: Start: 95654; End: 96709 Strand: -

Full Sequence      

MNREKLRVDVIIPAYRPDARFLLLMRRLFRQSVRPQKVIIMNTERELWERSGVEAELRKL
GVLSHCELHHIRKAEFDHGHTRNLGVRYSDAPCFIMMTQDAVPADEYLIERLLEPLLPEK
AASPGGDVRNHKEACAALQGAERGGGRVALSYGRQLPNRDADAIERLTRAYNYPAKSFTK
GIEDLPRLGIKTFFASDVCAAYDRAVFDRLGGFTDRAIFNEDMIYAAGLLRAGYRIAYAA
EARVRHSHNYSPAQQLHRNFDLAVSQAEHPEVFSGIRSEGEGIRMVLRTAKGLCREGHAG
LLPRLVLLSGAKYLGYRLGKSHRALPRKLTRRLSMSPGYWDRRSGQERADE

Enzyme Prediction     

No EC number prediction in MGYG000003786_00519.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	9.87e-07	83	251	74	224	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd02525	Succinoglycan_BP_ExoA	2.27e-06	82	246	73	207	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
COG1215	BcsA	5.18e-06	7	244	55	262	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd04186	GT_2_like_c	7.69e-06	182	248	99	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam13641	Glyco_tranf_2_3	3.91e-05	198	260	163	225	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK76837.1	1.51e-105	4	341	25	336
CBL24569.1	2.22e-100	4	340	2	305
QIX92497.1	1.26e-99	2	340	16	326
ANU46591.1	1.78e-99	2	340	16	326
QQQ98694.1	1.78e-99	2	340	16	326

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	3.94e-51	6	341	1	303	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003786_00519.