CAZyme Information: MGYG000003790_00345

Basic Information

• Species: Porphyromonas uenonis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas uenonis
• CAZyme ID: MGYG000003790_00345
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000003790_17|CGC1	38098.88	5.6701

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003790	1715041	MAG	Canada	North America

• Gene Location: Start: 10637; End: 11644 Strand: +

Full Sequence      

MKCSRMNEIRRDPTRLKRLLRYVTLALWGAVLVGIVYYFVVVYRAPQAEPAHAHVTPQTG
WRDVPIAEVGASEEYEELEQYGTLYVLEYLLDYDSIWPLDELQQGKSFGLYDEEEDDDEV
EVVEVVKVKQTKPTETPQASAEQSQEQSTRIQGVISDWDHLFQKYGNKYGWDWFVLASIA
YQESKFRAEVVGMGGATGLMGIMPATGRRYGYSRAKLKHAESSIRVACMALQDFGRSFAH
ITDAEQRMKFTLAAYNSGSAHVLDARRLAEDAGLDPDRWDGSVEIFMARLSEPKYYNDPL
VQHGRANGAHTVRYVTEVFSRAQSYKSKVQYATAK

Enzyme Prediction     

No EC number prediction in MGYG000003790_00345.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	171	331	5.6e-20	0.8592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	6.81e-67	162	326	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	4.03e-29	151	318	264	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	6.36e-26	150	315	282	440	membrane-bound lytic murein transglycosylase MltF.
pfam01464	SLT	6.45e-13	162	269	1	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16896	LT_Slt70-like	9.57e-13	163	277	9	121	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12384.1	2.44e-176	1	334	1	330
BAK25352.1	3.14e-51	153	328	294	471
AUR47574.1	3.14e-51	153	328	294	471
AKV63991.1	6.16e-51	153	328	294	471
ALO29436.1	6.16e-51	153	328	294	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	1.30e-14	151	318	252	414	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	1.33e-14	151	318	259	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.33e-14	151	318	259	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	1.87e-14	151	318	245	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	1.87e-14	151	318	245	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0AQY9	1.68e-18	150	318	281	444	Membrane-bound lytic murein transglycosylase F OS=Maricaulis maris (strain MCS10) OX=394221 GN=mltF PE=3 SV=2
Q1C5E6	4.64e-18	151	318	283	443	Membrane-bound lytic murein transglycosylase F OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=mltF PE=3 SV=2
Q74SQ6	4.64e-18	151	318	283	443	Membrane-bound lytic murein transglycosylase F OS=Yersinia pestis OX=632 GN=mltF PE=1 SV=1
A7FFU9	4.64e-18	151	318	283	443	Membrane-bound lytic murein transglycosylase F OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=mltF PE=3 SV=1
A9R413	4.64e-18	151	318	283	443	Membrane-bound lytic murein transglycosylase F OS=Yersinia pestis bv. Antiqua (strain Angola) OX=349746 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
19	41