CAZyme Information: MGYG000003792_01856

Basic Information

• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Brevibacteriaceae; Brevibacterium
• CAZyme ID: MGYG000003792_01856
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
300		31858.65	5.6499

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003792	2144916	MAG	Canada	North America

• Gene Location: Start: 1543; End: 2445 Strand: +

Full Sequence      

MHSEDKRYASSLQDTAEIPKVPTKPKEATKPQVAAKPKGTTKAATTSAGVSRWWAIPLMA
MSIAMVVLAGLLFVNLRTDGAASEAEEIVEIPAPVAPSMPAVDPVAGGVAVDNPWLRETS
EKSGIPKRVLQAYVAATVWAAQRSPQCGLSWNTLAGIGKVETDHGRYKGASVNDSGEVTP
HLFGVQLRGEGTAHIRDTDGGRLDGDRTHDRAVGPMQFIPTTWNQFAVDGNGDGAKDPHN
IDDAAASAAAFLCANNRNLSDLNGYTDAIKAYNPSDQYVRDVANEAQRIAQVMGQTAQTE

Enzyme Prediction     

No EC number prediction in MGYG000003792_01856.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	149	291	6.1e-20	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	2.38e-23	147	282	1	102	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG2951	MltB	1.76e-18	114	277	87	261	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
pfam13406	SLT_2	1.18e-05	212	243	155	187	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY09861.1	3.99e-61	92	294	30	225
BCW19040.1	4.22e-61	112	294	58	240
AWB85496.1	1.18e-60	76	283	46	263
SDT25097.1	6.94e-60	112	294	59	241
QCP04478.1	8.15e-60	80	286	35	250

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999852	0.000164	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
50	72