CAZyme Information: MGYG000003794_01008

Basic Information

• Species: Prevotella timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella timonensis
• CAZyme ID: MGYG000003794_01008
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412		46587.75	8.3755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003794	2491297	MAG	Canada	North America

• Gene Location: Start: 14524; End: 15762 Strand: +

Full Sequence      

MKIFRLISFLWLLLTGLVVQASNNQHHQQLIFETDSANEIPYRIPAIAQCRNGNLIAVSD
FRYCGSDIGYGAVDLVYRISKDYGNTWSPIAKLADGHGDENRIQWDYAFGDCGLVANRTN
SEVLAVCVAGKTVYFQGKRDNPNRVAVFRSNDNGKTWDKGHEITEQIYQLFDGRKQGPIQ
SLFFTSGRIHQSRYVKVGKYFRLYSGLCTLSGNFIVYSDDFGHQWKVLGNIDESPCKDGD
EVKCEELPDGSLILSSRAEGRMFNIFTFTNIKKGEGHWDSRQTASDMAHIKNQCNGEILV
LPVVRKSDGQETYLALQSVPFGPQRTNVGIFYKEIGKKHLSVLEFASHWKRGMLVHPGPS
SYSTMIAQKDGRIGFLCEVGQKNNHISYQSLDVEEITNNEFVLSKKRFKKGY

Enzyme Prediction     

No EC number prediction in MGYG000003794_01008.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	31	385	1.3e-46	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.85e-58	29	392	1	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	9.48e-05	71	374	14	279	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
PRK11545	gntK	0.002	90	143	35	91	gluconokinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48969.1	4.24e-172	27	405	25	403
QYR10380.1	1.41e-141	19	401	17	395
EFC70822.1	2.43e-103	28	406	20	407
QFQ12979.1	3.31e-100	28	404	20	400
QUB83288.1	3.37e-99	35	403	38	427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MHU_A	1.62e-17	31	407	39	402	ChainA, Exo-alpha-sialidase [Bacteroides acidifaciens],7MHU_B Chain B, Exo-alpha-sialidase [Bacteroides acidifaciens]
2BF6_A	3.70e-11	31	394	12	444	AtomicResolution Structure of the bacterial sialidase NanI from Clostridium perfringens in complex with alpha-Sialic Acid (Neu5Ac). [Clostridium perfringens]
2VK5_A	3.73e-11	31	394	12	444	TheStructure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK6_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_B The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens]
7LBU_A	5.00e-11	13	378	75	413	ChainA, Exo-alpha-sialidase [Cutibacterium acnes],7LBV_A Chain A, Exo-alpha-sialidase [Cutibacterium acnes]
5TSP_A	1.19e-10	31	394	13	445	Crystalstructure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124],5TSP_B Crystal structure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000297	0.999012	0.000203	0.000148	0.000141	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003794_01008.