CAZyme Information: MGYG000003799_00403

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Sodaliphilus
• CAZyme ID: MGYG000003799_00403
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
251		28910.72	9.499

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003799	2146274	MAG	Canada	North America

• Gene Location: Start: 90732; End: 91487 Strand: +

Full Sequence      

MPDIPKVIHYCWFGRKPLPPLALRCIASWRKHMPDHEIKEWNEDNFDVNMIPYTRQAYAA
RKYAFVSDVARFWILYHYGGVYFDTDVEVLKPLTPLLDRGPFMGVENMVSLSTDQLKVAP
GLGMACEAGMPVIRQFMEMYNNLEFSMQENGKFMTVVDFVSRSLNRVGLKHVNEVQQVAG
MTIYPADYFAARKTAVCNIPRTENSYTVHHYAGSWYPWHIKLKLKIARLLGTSLSKIVVS
LKREVLRGPKS

Enzyme Prediction     

No EC number prediction in MGYG000003799_00403.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	22	98	1.9e-24	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.34e-22	2	101	80	182	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.09e-20	19	102	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	2.49e-09	4	103	46	151	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ47479.1	5.72e-90	4	231	2	230
ALA75301.1	1.01e-85	4	245	2	245
QJR59783.1	1.01e-85	4	245	2	245
QJR55418.1	1.01e-85	4	245	2	245
AII69495.1	1.01e-85	4	245	2	245

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O14084	5.55e-10	1	103	61	169	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
Q10323	1.46e-06	4	121	57	177	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003799_00403.