CAZyme Information: MGYG000003800_01525

Basic Information

• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Mobiluncus
• CAZyme ID: MGYG000003800_01525
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1110	MGYG000003800_17|CGC1	118257.41	10.6204

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003800	2133089	MAG	Canada	North America

• Gene Location: Start: 2825; End: 6157 Strand: +

Full Sequence      

MRTAVTALIVTSGETPYLAATLLAVSRQTLAPQQVFVIDVSSSGVAHRSGTKVLKTPGAP
NLGEALRQAKAQPDFPTPAPGKPHALWILHDDSAPAPTCLAEQLKVLESGSSIKVVGAKQ
RLWDKANQIVEVGIRATRSGRRLQEMDTGEVDQGQYDGREDVLGVGTAGMLVDWETFCRL
DGFDPHLGPFGDGLEFSRRVHLAGYRVVVAPRAVVYHKMAGYFGLRGPDGGRPARSARSF
DPTGRDVEANGKLESDAKRSFTARRTAQLHNWMVAAPWWLFIFLPLIVLVLGLLRFFWRI
LTKEPKLAAGELQSTLVTVFRPFAAWQSRLRRVRQSKLSPRTLRPLQVKSSQIRQAKTTA
RRVAKDQRRPQIADSAARRNFYTEKAVDRTLVWVVAAALTLIGLLGWRFAIGGVSGGALA
NLPVNNQDFWADLISGWIPAGLGYGSAVGAVDPLGLEVASLGQIAGFVGVKGPVVLAVLL
FATLPLAWLSAWWAAGVLTDSRTLRALVALSWALSPNLLVSMGLGQLPVWVLAVSVPLFA
GSLARGTGMPVSRTVMGEIEPVTVNVHSAAIIQVGIAALTGFLTVSASVIMVIPVVLLVG
MAMLKGVANPLFAEAQTEAPDPGWSPIPARLRLKAVHALIVLAPAVLLAVPTVVRTVGTP
AQWPLWLSSLSVPLPTPRPNWWDLLAAWPVDVAATSLPIVLPGWQLLAFLPLALLLLTVV
AGVIIPGHSTGAHWSLLFALGGLVTAWLASSTPVSVSGANAVCAWCGPGLALFHAGLITS
ALFSVGRLQLTIPVEIANWSNRSVQAVVAVAVLIPVLGATPLLVNQMVAPGASDFNALAT
FRDVSLPATVAQGQSSPRHLRALNLEVSSAPNQSTLVTAGLWRDWRDTTFEASPYLKLKN
YRNVTGSRTPDAADAVLQATVASVLGGSTPKLGEQLAQLDVNFIIVPRSKDAATTTLINT
LDSAAPLERITTTEAGTVWRLVDSAAVSVARVAPAQWKGGHPSWPTGEVTAQALNVRGGK
THVEAGPAGRLLAFSERADSSFTVRFNGKIIEPVDSGQWNALYQLPPNPGTVTITYAYLP
YQLWGAVLLLSLLIALAAALPLRRVSEVRL

Enzyme Prediction     

No EC number prediction in MGYG000003800_01525.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	4.90e-11	1	312	1	294	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd00761	Glyco_tranf_GTA_type	5.15e-04	7	148	1	143	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04185	GT_2_like_b	0.002	7	105	1	102	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04186	GT_2_like_c	0.003	9	218	3	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam13641	Glyco_tranf_2_3	0.004	5	223	4	217	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT12788.1	0.0	1	1110	1	1110
ADI67398.1	0.0	1	1110	1	1110
QQU08867.1	0.0	1	1110	1	1110
QDB78491.1	8.06e-119	7	1107	15	1118
QVI64848.1	4.09e-113	1	1109	19	1165

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
275	297
390	412
475	497
518	540
577	599
635	657
703	725
732	749
764	786
807	829
1080	1102