CAZyme Information: MGYG000003801_00980

Basic Information

• Species: SFGY01 sp004556455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Saccharofermentanales; DTU023; SFGY01; SFGY01 sp004556455
• CAZyme ID: MGYG000003801_00980
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase Mel36A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785	MGYG000003801_16|CGC1	88874.68	5.8632

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003801	1919412	MAG	Canada	North America

• Gene Location: Start: 38452; End: 40809 Strand: +

Full Sequence      

MIEVRDKLFHLQTDASSYLFCVGDFGHLEQIYYGPRVQTEDAAALRYRRTMPYGSQVMWD
EQSEFSLDNLPLNWSGVGRGDYRQPPLELCFADGSLSHDFLFVDYDLCDGVKPMHGLPTA
TAGDSSRVQTLTLTLQEQAHPLRLQLIYTVFPETNVISRRAVLLNQGEEAVTLHRFLSFL
LDLPNRNFRMLSLRGDWIREAERTEQPLVQGLLINQSTTGDSSNRQNPGVILAEAGANED
QGFVYGFNLVYSGNHFTLLELSSHGLVRVAGGVNPQSFHWQLDQGAAFETPEAILSFSEQ
GLNGLSQNFHRFVNEHIVRGPWRMKERPLLLNSWEALNFDFTEKKLLKLAEQGRKLGVEL
FVLDDGWFGARDNDHAGLGDYTVNSRKLPSGLPVLARRIHEMGLSFGLWLEPESVNPDSD
LYRAHPDYAISAPGLKPLTSRHQFLLDLTRQEVRDYIVQEVSELLDSAEIDYVKWDMNRH
MSEFYSPGCLAGEFCHRYILGLYEILNRIFGPRPQILLESCSSGGNRFDLGMLAFSPQIW
ASDNTDPIERLRIQSGLSLFYPLSSMGAHVSLAPHQQTLRNTPLSTRFNVAAFGLLGYEL
DPGELSKEEAKEVEQQLCFYKRYRRLFQFGKFYRGESFKTNKYQWLCVDESGKQAVALLA
QTLSWAGESNDMLCLKGLLPEVRYQLKTVPQKLALRRFGHLVKHALPIKIKARSPLFAMI
DARYSLDDGAFSVQASGAALAAGICLNNQFIGTGYHKDLRLWGDFGSQLYLLQAEDHQEE
SGEEK

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	8	689	2.9e-241	0.9752906976744186

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3345	GalA	1.81e-179	8	686	3	648	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	1.49e-174	288	630	2	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14791	GH36	4.20e-131	326	622	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	2.63e-87	26	283	1	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
cd14792	GH27	2.02e-13	332	408	6	84	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAS11970.1	3.56e-293	1	773	1	771
AIN94740.1	2.04e-292	1	773	1	771
AEC01994.1	1.17e-290	1	776	1	778
ABX42304.1	1.74e-279	1	773	1	811
QFR64011.1	6.62e-266	1	775	1	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FNQ_A	2.20e-185	5	687	8	693	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
3MI6_A	1.03e-184	2	690	5	699	ChainA, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_B Chain B, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_C Chain C, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_D Chain D, Alpha-galactosidase [Levilactobacillus brevis ATCC 367]
2XN0_A	1.36e-184	5	685	11	694	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	3.84e-184	5	685	11	694	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
4FNR_A	6.97e-184	5	687	8	693	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43467	8.61e-186	2	685	6	693	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
G1UB44	7.45e-184	5	685	11	694	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
Q9ALJ4	3.81e-183	5	687	8	693	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G4T4R7	7.72e-169	7	684	10	682	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
P27756	2.42e-146	2	634	3	632	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003801_00980.