CAZyme Information: MGYG000003803_03247

Basic Information

• Species: Pantoea conspicua
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea conspicua
• CAZyme ID: MGYG000003803_03247
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277		31898.13	4.5718

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003803	3817683	MAG	Canada	North America

• Gene Location: Start: 1166; End: 1999 Strand: +

Full Sequence      

MFAWVTLLTQPDYLVGVKALHHSLKQSNSQWPLVVMTTSAISTDDCQALQAEGCVIAPVE
PIYPRADLDQHYASAQFGEVWTKLRAWQLTDYQRVVFLDADMLVLQNMDELFTLDLGDNL
MAACHACRCNPNQIASYPADWQPEQCHYTWQARNQPAPASLDYYLNGGFLVLTPDNAVYD
ALEQRIAAIDDLSDYPFSEQDLLNEAFAGRWKPLSYIYNALKTLPFQHSPIWRDDEVKNL
HFILAKPWKRDLAQPESQRDRYYMLDKLWWEKSGLAC

Enzyme Prediction     

No EC number prediction in MGYG000003803_03247.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	4	251	9.6e-51	0.8754863813229572

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02537	GT8_Glycogenin	1.06e-74	2	271	1	235	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
PLN00176	PLN00176	2.15e-35	3	271	24	289	galactinol synthase
cd04194	GT8_A4GalT_like	1.82e-19	89	249	93	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	2.07e-17	12	251	9	251	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd06914	GT8_GNT1	5.97e-14	2	277	1	265	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOE38439.1	9.70e-187	1	275	1	275
QGY57666.1	1.96e-186	1	275	1	275
AYP22748.1	1.96e-186	1	275	1	275
QTC51854.1	3.95e-186	1	275	1	275
AZI51548.1	3.95e-186	1	275	1	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3USQ_A	1.95e-13	3	248	25	240	Structureof D159S/Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
3USR_A	1.95e-13	3	248	25	240	Structureof Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
3V90_A	3.62e-13	3	248	25	240	Structureof T82M glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus],3V91_A Structure of T82M glycogenin mutant truncated at residue 270 complexed with UDP-glucose [Oryctolagus cuniculus]
6MW5_A	3.86e-13	3	271	9	254	UDP-galactose:glucoside-Skp1alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]
1ZCT_A	4.89e-13	3	248	25	240	structureof glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus],1ZCT_B structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4PSY4	3.74e-39	3	271	21	287	Galactinol synthase 7 OS=Arabidopsis thaliana OX=3702 GN=GOLS7 PE=2 SV=1
O22693	1.79e-35	3	271	24	290	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1
Q8H1S1	1.40e-34	3	271	26	292	Galactinol synthase 6 OS=Arabidopsis thaliana OX=3702 GN=GOLS6 PE=2 SV=1
Q9FFA1	3.60e-34	3	271	23	289	Galactinol synthase 5 OS=Arabidopsis thaliana OX=3702 GN=GOLS5 PE=2 SV=1
Q9XGN4	7.03e-34	4	271	25	289	Galactinol synthase 1 OS=Ajuga reptans OX=38596 GN=GOLS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003803_03247.