CAZyme Information: MGYG000003804_01528

Basic Information

• Species: Epilithonimonas bovis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Weeksellaceae; Epilithonimonas; Epilithonimonas bovis
• CAZyme ID: MGYG000003804_01528
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242		27625.95	5.9718

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003804	1849488	MAG	Canada	North America

• Gene Location: Start: 1184; End: 1912 Strand: -

Full Sequence      

METIKKYVDEMLVILPFEKDFYKKHQVEAHFVGHPLLDAIEGLPPIDGQTFKKENHLNDK
EIIALLPGSRKQEISKMLQIMLSVRDHFPDYQFVIAGAPSLDKDFYEQFVDDDVHFVSNR
TYDLLRCSKAALVTSGTATLETALLNIPEVVCYKGSRISYEIGKRLIRNIKYISLVNLIM
DKEVVTELIQNDLNTKNLVEELDKILNTKKRDEVLTDYEILRTKLGGNGASENAAKIIVN
LK

Enzyme Prediction     

No EC number prediction in MGYG000003804_01528.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	2	225	2.3e-72	0.6384180790960452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.01e-71	4	241	131	374	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.33e-66	4	241	133	378	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.93e-49	2	238	128	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.79e-44	4	241	135	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.33e-43	4	241	124	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIY84733.1	2.16e-168	1	242	127	368
AZI39159.1	3.42e-154	1	242	127	368
AZI56097.1	1.61e-152	1	242	127	368
AZA96589.1	3.12e-130	1	241	127	367
AZA88028.1	3.12e-130	1	241	127	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	4.66e-26	4	241	136	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	6.45e-26	4	241	136	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	2.25e-42	1	241	130	377	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B6J161	2.92e-41	1	241	130	373	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
B6J9H1	4.10e-41	1	241	130	373	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
A9KC41	4.10e-41	1	241	130	373	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
Q83DS5	8.06e-41	1	241	130	373	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003804_01528.