CAZyme Information: MGYG000003806_00095

Basic Information

• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium
• CAZyme ID: MGYG000003806_00095
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
705	MGYG000003806_2|CGC1	78721.18	4.3818

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003806	2539854	MAG	Canada	North America

• Gene Location: Start: 33134; End: 35251 Strand: +

Full Sequence      

MAQLGDVTTRDLLQELAQRHGVACEYTAQNGQPVYVSDETITYTLRALGVSISDRPDDEE
LTQALFEDYLERASRPLPPCVVAREGAEKSFAVHVHDGDPVTVTIELENGETRPTYQDPN
DAPAADVAGTMWGEASFHVPGDLPLGFHKLRLSSPGIGEHECPLIVVPNHLSTADRYLDH
PAAGAMAQLYSVRSEKSWGMGDFGDLAELAETLAPDYDFLLINPLHAGEPIPPVEDSPYL
PTTRRFINPIYIRIEDIPELKLLSPELQEDVAELAAEFRERNRSAEEIDRDSIFEAKLQV
LQELFNQEMTPERRTAFSEYQRREGRGLRNFALWCAETELDRHSGRRHALSLDVNDLAEF
YSWLQFLCDEQLDAAQRRALDAGMSIGLITDMAVGIHPAGADAVNLSEYLAPQCSVGAPP
DDYNQQGQDWSQPPWHPVRLAEAGYEPWRDLLRTMLGNAGGLRVDHVLGLFRLYWIPRHS
TPLNGTYVTYDWEAMLGILALEAERAGAVLVGEDLGTLEPWVQNALRDMGVLGTTIIWFE
HANEGPTPRPQDQYRHMAMSSVGTHDLPPTLAFLRGDHIALRARLGLLTRPVTEEEAEDR
AWQEEVKDNLQAYGMLENRENEEDVLVALHRYIAGTPSALTVTNVVDMVGDVRAQNQPGT
TKDQYPNWCIPLCNTAGEPVLLEDLPKQELYQRLAQAAKRPGAEH

Enzyme Prediction     

No EC number prediction in MGYG000003806_00095.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	188	678	3.6e-124	0.9554655870445344

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1640	MalQ	1.78e-143	184	685	15	505	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
pfam02446	Glyco_hydro_77	3.50e-126	188	672	2	457	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PRK14507	PRK14507	9.44e-124	10	697	5	716	malto-oligosyltrehalose synthase.
PRK11052	malQ	5.70e-122	9	668	2	661	4-alpha-glucanotransferase; Provisional
PRK14510	PRK14510	9.45e-82	182	668	724	1190	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQU92475.1	0.0	1	704	1	704
ACP33410.1	0.0	1	704	1	704
QQU96600.1	0.0	1	704	1	704
QQA79761.1	0.0	1	701	1	701
QPS59449.1	0.0	1	701	1	701

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B68_A	2.10e-282	7	700	1	705	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]
4S3P_A	6.66e-73	53	688	3	686	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	8.41e-69	129	688	90	686	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]
6M6T_A	4.83e-07	286	566	98	397	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P65337	8.96e-193	13	699	8	714	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P9WK22	8.96e-193	13	699	8	714	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1
P9WK23	8.96e-193	13	699	8	714	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1
P45176	1.48e-74	143	672	110	673	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1
P15977	2.53e-72	53	700	3	694	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003806_00095.