CAZyme Information: MGYG000003806_00779

Basic Information

• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium
• CAZyme ID: MGYG000003806_00779
• CAZy Family: GT87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422	MGYG000003806_15|CGC1	46873.65	9.1515

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003806	2539854	MAG	Canada	North America

• Gene Location: Start: 29406; End: 30674 Strand: +

Full Sequence      

MNFATNAARRTLLTAAGLIIGLVGVIRHVLHTDFPVDMIIYREGVRAFMEGRSVYSDPMY
AGDLALPFIYPPFGALVMVPLTAFDWMSDALAGDIMIVLSDALVFACLYAIFRALKVPHL
WPTVAIAWAAAMFFEPIRLNNGFAQINIVIMALVIFDLVPRKRKLPQGWLIGLAAAIKIT
PLAMLLYFLLRREWKPILTAFASAVVATLLAAAYRWEAFVEFFSSKLLDMGKGADFGVAT
DYQSNSSLKGVIQRLFTSQEAMDNHGTLINVLWLVAALVIIGLGSALILAQIRRGLLVDA
HLTTATTMLLISPVSWSHHWVWLSLIVPVLVYRAWSWRNSTWVAGSLLAVLAAWVGMLLT
VPPKWWFGDSIDVHAMPLYQKFLVDDFVWLALLSWILYAICLKVKGTQSDKPHTELAAAQ
TN

Enzyme Prediction     

No EC number prediction in MGYG000003806_00779.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	68	313	3.5e-60	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13375	pimE	7.04e-29	36	361	45	349	mannosyltransferase; Provisional
pfam09594	GT87	9.82e-28	68	313	1	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.
COG5650	COG5650	3.44e-04	54	191	136	263	Uncharacterized membrane protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACP32720.1	2.03e-291	1	419	1	419
QQU93113.1	2.03e-291	1	419	1	419
QRP60838.1	1.70e-267	1	422	1	422
VEG05837.1	2.30e-265	1	418	1	418
QQA80428.1	2.30e-265	1	418	1	418

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R036	7.54e-46	34	414	45	421	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4247 PE=1 SV=1
P9WMZ8	1.63e-41	31	351	40	362	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	1.63e-41	31	351	40	362	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1
A0R2K8	5.43e-20	36	399	57	405	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimE PE=1 SV=2
P9WN00	4.93e-13	36	332	69	350	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000010	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	31
64	83
90	112
117	134
141	158
168	190
197	219
268	290
340	362
382	404