CAZyme Information: MGYG000003806_01792

Basic Information

• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium
• CAZyme ID: MGYG000003806_01792
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
207		22383.38	4.1564

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003806	2539854	MAG	Canada	North America

• Gene Location: Start: 6; End: 629 Strand: +

Full Sequence      

MPNIDVEAPGRTADKLTWWSDQLADATSIPAQALRAYGNAELIARESWPNCNLRWNTLAG
IGWVETRHGTYSGNIFHRSSLDENGHPEPPIVGIPLDGTNNTTHVPDSDGGVFDDDTEFD
RAVGPMQFIPSSWGHFGRDANGDGVADPNQIDDAALGAAALLCFGDRDLSTPEGWRSAIL
NYNQSEDYLRKVAAAANSYAIEQPATS

Enzyme Prediction     

No EC number prediction in MGYG000003806_01792.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	53	201	7.6e-19	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2951	MltB	5.97e-26	2	200	71	276	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
cd13399	Slt35-like	1.81e-17	51	198	1	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13406	SLT_2	2.29e-04	122	147	155	180	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQU93311.1	1.60e-143	1	207	57	263
QQU95257.1	2.27e-143	1	207	57	263
ACP32510.1	4.64e-143	1	207	87	293
QQA78435.1	1.99e-137	1	207	57	263
SQI00325.1	1.99e-137	1	207	57	263

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000003	0.000046	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003806_01792.