CAZyme Information: MGYG000003808_00464

Basic Information

• Species: Pauljensenia culturomici
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia culturomici
• CAZyme ID: MGYG000003808_00464
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614		67506.89	6.8328

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003808	2368539	MAG	Canada	North America

• Gene Location: Start: 50; End: 1894 Strand: -

Full Sequence      

MARADTLNRMTHASIAAVVVAYNRASMLRDTLDALAAQTRPLDDVVVIDNASTDGSAGVA
DSHGVVTDLVRMPENLGGAGGFAAGISRAIARGADFVWLMDDDTVPSPTALAELVKARDA
YPGQPALLACRADWIDGREHPMNTPRERFLIDPALRERAARVGAKQIRTSSFVAVLIDAR
AIREEGLPVADYFLWNDDFEYTARLLRHRVGLYVDAARVEHRTRAFASSTDVDPGPRFFN
EVRNKVWAFSRSRALGPLDTTVFGGATLLRWVRMIAGSESRSDRLRDLRDGLVQGSRTPR
PTAEILWDTPVGRQSAVLEAGAPMGRLPRRSDAPLDFAVLLPVWKGDAPEFFERSLRSIG
ADQTRRASLIVLVCDGPVAPGVDEVLAAAEAGERDDLTGGIPVRVVRIPTNRGLSNALNE
GLAVCEYDVVARADADDISLPHRFAMQLPLVEEGFELVGSAIAEFEVDEDERGLVRRMPL
GTREIRETITKRDPFNHPTVVYTKSAVAQAGGYEHVDHMEDYWLFARMVATGIPCCNVQE
PLVLYRIGDGAYKRRGGLQMFKSEVALQRLLANAGLTSRAQELKNIVVRGGYRLVPAHVR
KALYQNVGRILWFR

Enzyme Prediction     

No EC number prediction in MGYG000003808_00464.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	17	120	2.8e-22	0.611764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04195	GT2_AmsE_like	1.23e-70	339	546	2	201	GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04185	GT_2_like_b	3.06e-48	17	247	1	201	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	9.04e-28	14	291	4	284	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	1.11e-16	18	223	2	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02526	GT2_RfbF_like	2.05e-16	17	222	1	204	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPK80727.1	1.64e-295	10	614	1	607
SDT98587.1	2.19e-237	7	605	17	635
ANC32836.1	1.30e-204	10	609	1	609
ABS05353.1	9.50e-190	15	605	20	616
QWC84037.1	1.80e-183	15	607	10	592

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48215	2.81e-50	335	606	1	263	Uncharacterized glycosyltransferase HI_1695 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1695 PE=3 SV=2
Q46635	1.31e-42	337	606	2	262	Amylovoran biosynthesis glycosyltransferase AmsE OS=Erwinia amylovora OX=552 GN=amsE PE=3 SV=2
P9WMX2	1.03e-16	14	251	4	254	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1
P9WMX3	1.03e-16	14	251	4	254	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1
A0R5Z2	4.81e-15	10	207	1	203	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003808_00464.