CAZyme Information: MGYG000003808_00526

Basic Information

• Species: Pauljensenia culturomici
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia culturomici
• CAZyme ID: MGYG000003808_00526
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484	MGYG000003808_16|CGC1	52747	6.7383

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003808	2368539	MAG	Canada	North America

• Gene Location: Start: 3996; End: 5450 Strand: -

Full Sequence      

MMSPLHQRTRMDRAVGVMVLLLAAGAALVLVAGIVLSGSGMTPDLREGVADSLHYIWDPE
VPRWGLLIGASGLALALALAGLVTGVEHIVATRARRAEDRGDNPLAPRVVMADTAGRFDG
EVTITVCVPAHNEADRIQATLDSLRAQDGAPERIIVVTDNCTDRTVEIARAAGVDVFETI
DNTHKKAGGLNQCLTGLLPTLGNNDCVMVMDADTVLDQGFLAEARRRLTADRALMAVTGL
FYGEDGGGLLGLCQRNEYTRYSRDIERRQGKVFVLTGTATVFRARALRTVAQERGRLLPG
TPGDVYDTAALTEDNEMTIALKSLGALMISPSNCRVVTEVMTTWKALWNQRLRWQRGALE
NLGTYGLTPQTSRYWSQQLGIGYGVLALLAYFVMMTIMALSLAQWVWFPFWLAVGGVFAL
ERVVTAWKGGWAARFLAVLVIPELIYATYLNIVFCKGCLDILRAKQAEWTHVAADGSVVR
EEKP

Enzyme Prediction     

No EC number prediction in MGYG000003808_00526.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	125	289	3e-21	0.9823529411764705
GT2	207	418	3.2e-19	0.9796954314720813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	1.42e-38	123	455	55	392	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.37e-33	128	314	3	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06438	EpsO_like	1.11e-25	126	231	1	109	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
pfam00535	Glycos_transf_2	9.45e-20	125	287	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	2.89e-18	126	239	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGU00982.1	5.07e-198	11	469	6	462
QKE84664.1	5.66e-198	10	479	5	475
QHB99039.1	2.46e-197	11	482	8	480
QSR27002.1	5.56e-194	10	482	25	494
SDT42057.1	2.40e-193	10	472	3	464

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6G608	4.75e-13	124	374	49	288	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaA PE=3 SV=1
Q8NUI7	4.75e-13	124	374	49	288	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaA PE=3 SV=1
Q5HCN1	1.50e-12	124	374	49	288	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6GDD8	1.50e-12	124	374	49	288	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	1.50e-12	124	374	49	288	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000003	0.000027	0.000000	0.000000	0.000000	0.000006

TMHMM  Annotations     

start	end
13	35
64	86
379	401
405	424
431	453