CAZyme Information: MGYG000003811_01885

Basic Information

• Species: Corynebacterium amycolatum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium amycolatum
• CAZyme ID: MGYG000003811_01885
• CAZy Family: GT51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288	MGYG000003811_116|CGC1	29387.88	3.9484

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003811	2349574	MAG	Canada	North America

• Gene Location: Start: 2993; End: 3859 Strand: -

Full Sequence      

MAHRLGVAESIPGIEKTLMDDNGHSQDGITLGQYLSRPLDMAVGLATLTNDGVYQQTHFV
EKVENSKGEIVYESNADKGDRRVSKAVATNVISAMEPVAGYSNKPLSGGRPSAAKTGTTQ
LGDTGQNKDAWMIGSTPQLSTAVWVGNVDGSALYNAYGGIMYGAQTPGDLWKYTMDNALS
NEDFEYFTKPEPIGGVAGAPQYQAPSTSDSGYDQGSAPETTEEESAEESTSESSEEQPAP
LPVPGGDGGGGGGGGGIADLLPIPLPGGGGLDSGNEGGGDPGNPGGGQ

Enzyme Prediction     

No EC number prediction in MGYG000003811_01885.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	4.26e-31	1	218	441	634	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	5.75e-23	29	181	387	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	1.88e-13	37	193	563	733	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	7.12e-08	28	218	430	602	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
pfam00905	Transpeptidase	5.60e-07	5	138	131	260	Penicillin binding protein transpeptidase domain. The active site serine is conserved in all members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQU97204.1	8.17e-153	1	288	540	826
AIN81612.1	8.17e-153	1	288	540	826
AYX80715.1	1.01e-147	1	288	540	825
ASE56981.1	1.01e-147	1	288	540	825
QPR31324.1	1.70e-140	1	214	540	753

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CXW_A	1.05e-62	2	200	173	377	Structureof the PonA1 protein from Mycobacterium Tuberculosis in complex with penicillin V [Mycobacterium tuberculosis H37Rv]
5CRF_A	3.84e-59	2	200	173	377	Structureof the penicillin-binding protein PonA1 from Mycobacterium Tuberculosis [Mycobacterium tuberculosis H37Rv],5CRF_B Structure of the penicillin-binding protein PonA1 from Mycobacterium Tuberculosis [Mycobacterium tuberculosis H37Rv],5CRF_C Structure of the penicillin-binding protein PonA1 from Mycobacterium Tuberculosis [Mycobacterium tuberculosis H37Rv],5CRF_D Structure of the penicillin-binding protein PonA1 from Mycobacterium Tuberculosis [Mycobacterium tuberculosis H37Rv]
3ZG8_B	5.34e-13	10	146	299	431	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	1.84e-11	10	146	299	431	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
2Y2G_A	3.31e-10	44	153	273	387	Penicillin-BindingProtein 1b (Pbp-1b) In Complex With An Alkyl Boronate (A01) [Streptococcus pneumoniae R6],2Y2G_B Penicillin-Binding Protein 1b (Pbp-1b) In Complex With An Alkyl Boronate (A01) [Streptococcus pneumoniae R6],2Y2H_A Penicillin-Binding Protein 1b (Pbp-1b) In Complex With An Alkyl Boronate (Za2) [Streptococcus pneumoniae R6],2Y2H_B Penicillin-Binding Protein 1b (Pbp-1b) In Complex With An Alkyl Boronate (Za2) [Streptococcus pneumoniae R6],2Y2I_A Penicillin-Binding Protein 1b (Pbp-1b) In Complex With An Alkyl Boronate (Za3) [Streptococcus pneumoniae R6],2Y2J_A Penicillin-Binding Protein 1b (Pbp-1b) In Complex With An Alkyl Boronate (Za4) [Streptococcus pneumoniae R6],2Y2K_A Penicillin-Binding Protein 1b (Pbp-1b) In Complex With An Alkyl Boronate (Za5) [Streptococcus pneumoniae R6],2Y2L_A Penicillin-binding Protein 1b (pbp-1b) In Complex With An Alkyl Boronate (e06) [Streptococcus pneumoniae R6],2Y2L_B Penicillin-binding Protein 1b (pbp-1b) In Complex With An Alkyl Boronate (e06) [Streptococcus pneumoniae R6],2Y2M_A Penicillin-Binding Protein 1b (Pbp-1b) In Complex With An Alkyl Boronate (E08) [Streptococcus pneumoniae R6],2Y2N_A Penicillin-Binding Protein 1b (Pbp-1b) In Complex With An Alkyl Boronate (E07) [Streptococcus pneumoniae R6],2Y2O_A Penicillin-binding Protein 1b (pbp-1b) In Complex With An Alkyl Boronate (eo9) [Streptococcus pneumoniae R6],2Y2P_A Penicillin-binding protein 1b (pbp-1b) in complex with an alkyl boronate (z10) [Streptococcus pneumoniae R6],2Y2Q_A Penicillin-Binding Protein 1b (Pbp-1b) In Complex With An Alkyl Boronate (Z06) [Streptococcus pneumoniae R6],2Y2Q_B Penicillin-Binding Protein 1b (Pbp-1b) In Complex With An Alkyl Boronate (Z06) [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R7G2	4.04e-67	2	204	502	709	Penicillin-binding protein 1A OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=ponA1 PE=3 SV=1
P71707	3.96e-59	2	200	563	767	Penicillin-binding protein 1A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ponA1 PE=1 SV=3
A0A0H2ZMF9	3.85e-09	28	146	501	622	Penicillin-binding protein 2a OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) OX=373153 GN=pbp2a PE=1 SV=1
Q8DNB6	3.85e-09	28	146	501	622	Penicillin-binding protein 2a OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbp2a PE=1 SV=1
P38050	9.37e-08	38	193	460	610	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003811_01885.