CAZyme Information: MGYG000003812_00096

Basic Information

• Species: Prevotella colorans
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella colorans
• CAZyme ID: MGYG000003812_00096
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MGYG000003812_2|CGC1	46595.99	9.9305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003812	2316911	MAG	Canada	North America

• Gene Location: Start: 6812; End: 8032 Strand: +

Full Sequence      

MNGKTHDTGYKAWIFLAFLTAIMLPCACTIDQSDTTVVTYSNMTYRGETVNGKREGLGAL
YAGDSLVYSGAWHNNMRHGKGWAIDSLGRKVDAIWDHDTIVTGTRHDSLGVYRGQFDHQL
MAHGHGTYRDAEGGIFEGVWRHDKRNGFGFSSQRSLFRVGEWKNNVYKGERLSYSSDRIY
GIDISKHQHVKKKKHYKIFWDKLRITHLGTLSKKSINDVVDYKISFIFIKSTEGTSVVNK
FYKADYAAARAHGYPVGSYHFFSYHTSGSAQAATFLRHSYFKKDDLPPVLDLEPLPSHVK
KMGGAHAMWRRVRAWLYAVERKTGMRPILYVSQMFVNKYLDEAPDIKSGYPVWIARYGEY
KPDVKLWIWQLAPDGRVSGIHGDVDINIFNGYSNEFKQWLEKVRMK

Enzyme Prediction     

No EC number prediction in MGYG000003812_00096.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	217	380	3.3e-39	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	2.96e-45	180	391	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd00599	GH25_muramidase	2.73e-37	224	389	22	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06413	GH25_muramidase_1	4.25e-36	223	391	24	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam01183	Glyco_hydro_25	2.53e-30	221	380	17	180	Glycosyl hydrolases family 25.
COG3757	Acm	6.00e-27	225	400	87	264	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29361.1	3.85e-190	2	406	7	413
ALO48884.1	1.77e-137	40	400	36	397
BCS86499.1	1.94e-120	52	402	4	354
QUB47627.1	2.36e-120	13	401	8	403
QNT67810.1	2.91e-116	107	406	53	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	8.21e-20	224	399	38	216	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	2.72e-14	224	391	27	204	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
5A6S_A	1.07e-13	204	401	17	210	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]
2X8R_A	8.51e-09	213	398	13	206	Thestructure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_B The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_C The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_D The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_E The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_F The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293]
6ZM8_A	3.05e-07	226	357	26	162	ChainA, muramidase [Sodiomyces alcalophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8FFY2	1.20e-27	175	404	63	269	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P76421	1.65e-27	175	404	63	269	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8X7H0	1.16e-26	175	404	63	269	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P25310	4.35e-13	224	391	104	281	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	7.01e-12	209	389	19	196	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000249	0.203803	0.795698	0.000070	0.000083	0.000075

TMHMM  Annotations     

start	end
13	35