CAZyme Information: MGYG000003812_01784

Basic Information

• Species: Prevotella colorans
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella colorans
• CAZyme ID: MGYG000003812_01784
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345	MGYG000003812_82|CGC1	39402.75	6.5704

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003812	2316911	MAG	Canada	North America

• Gene Location: Start: 5853; End: 6890 Strand: -

Full Sequence      

MTCALVTAGNTSTPANQLLKRLKAIQLKGVMVGHQDDPVYGQNWKWERGRSDVKEVCGDY
PAVMGFELGGIELGHEANIDQVPFDRMRDEIIEQHLRGGISTLSWHPFNPVTGKNAWDPS
GNPVRTLLCGGAQQDKFELWIGIVANFLNSLKTPNGQKVPVIFRPWHEMNGGWFWWGAES
TTPEEFKQLFVTTHQKLTKDYGCDHLVWCYSPNTGFQDYLAQYPGDSYVEILGIDIYDFK
HDNATYTKNVKHDLSELTRIGKEKQKLIALTETGAQQLPDANWFTEVFWKAVEPFPISYA
LFWRNAWDNHKELYMAAPGHLTAPNFKKFSKIEKTLFVNDMKDIK

Enzyme Prediction     

EC	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	10	308	6.3e-63	0.9042904290429042

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.45e-32	10	237	4	230	Glycosyl hydrolase family 26.
COG4124	ManB2	8.78e-24	155	280	176	302	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGH13968.1	1.95e-177	8	345	20	357
BCS86241.1	5.13e-162	10	341	18	349
QUB85259.1	6.44e-155	13	342	14	348
QNT67784.1	1.56e-126	12	345	28	367
QUB47762.1	2.09e-116	12	342	29	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	3.09e-98	18	340	15	338	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	3.56e-70	18	341	45	391	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	3.56e-70	18	341	45	391	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	6.59e-70	18	341	68	414	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	2.79e-69	18	341	45	391	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	1.89e-37	30	306	73	363	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	1.14e-33	10	339	46	396	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	4.53e-23	53	308	79	329	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P49425	4.48e-22	30	290	170	424	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	1.53e-21	15	289	183	439	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003812_01784.