CAZyme Information: MGYG000003814_00110

Basic Information

• Species: Prevotella sp900548585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900548585
• CAZyme ID: MGYG000003814_00110
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000003814_2|CGC1	39763	10.1002

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003814	1857523	MAG	Canada	North America

• Gene Location: Start: 42654; End: 43727 Strand: +

Full Sequence      

MISGNNGIYNMANVRRLCYVSRNYKGMHSAGNKAKGDYEDIMAMMGARNLGLRRTYCKER
IAAFLIDLAGIVTYALSVRKGDVVFLQYPTKKYFAMMCRVARWRGAKTMAFIHDLGAFRR
KRLTVEREIRRLSHADQIIAANDVMAEWLTGHGLRRPCRGLGLHDYLSASEADGKPSSFP
PRRIVYAGSISERKNMFLTGLAGRLRDCVVDVYGTNHIVGLKPSRNLMLHGPVEPDEFIA
TVAGDFGLVWDGDSLTACTGAFGEYLRVNSPHKASFYLRAGLPLIVWSRSAIADIVEREG
IGIAVERIDDIEERLGGITEDGMRRMRDNVRRVSHGLAQGMSMRKAVGEALREIGGK

Enzyme Prediction     

No EC number prediction in MGYG000003814_00110.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	27	350	2.5e-81	0.9720496894409938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	1.12e-69	27	354	13	333	sugar transferase.
cd03794	GT4_WbuB-like	1.45e-08	79	333	97	376	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
pfam13579	Glyco_trans_4_4	0.003	82	156	73	149	Glycosyl transferase 4-like domain.
cd03801	GT4_PimA-like	0.005	79	332	81	346	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03811	GT4_GT28_WabH-like	0.010	64	198	67	205	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85168.1	2.13e-109	15	354	3	343
QUU07104.1	1.04e-85	17	357	2	342
QQT78203.1	8.31e-85	17	355	2	340
QRP56553.1	8.31e-85	17	355	2	340
ASM65269.1	8.31e-85	17	355	2	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	1.78e-14	16	351	4	326	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]
3QKW_A	9.98e-10	16	351	4	326	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	1.03e-09	16	351	12	334	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	1.23e-32	30	354	14	327	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
B3XPQ7	4.82e-15	25	351	11	329	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	3.10e-14	25	354	16	337	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1
A0A0M3KKZ0	9.61e-14	16	351	2	324	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2
Q9AEU1	1.16e-11	77	354	61	332	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003814_00110.