CAZyme Information: MGYG000003814_00405

Basic Information

• Species: Prevotella sp900548585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900548585
• CAZyme ID: MGYG000003814_00405
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299		33914.92	9.2814

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003814	1857523	MAG	Canada	North America

• Gene Location: Start: 18430; End: 19329 Strand: +

Full Sequence      

MQKHITCIALLILSCYLHCTAQGQILNSAYIKYIDRYSCLAVEQMQLHGIPASITLAQGL
IESGAGQSELARNGNNHFGIKCHGWMGRTVYHDDDLSGECFRAYDNVRQSYEDHSMFLVN
GRRYRSLFSLSPGDYRGWAIGLKAAGYATNPSYADMLIRIIEQYRLYEFDGSVKRPAIPV
ETKEEEFKVQMCNGTPYVVARCGETLRSVSEMTGVSVRRLAKYNEMARNSVLRQGAPIYL
ERKPKRASRVYRGVYHEVVAGESMHSIAQKYAMRVGTLYRINNLPPEYGIKVGDKLRIR

Enzyme Prediction     

No EC number prediction in MGYG000003814_00405.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	41	166	3e-32	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.08e-38	8	172	14	190	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	1.60e-35	33	170	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	6.97e-28	27	170	5	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	8.75e-28	40	166	3	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK12709	flgJ	1.74e-19	33	163	176	318	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH15664.1	9.82e-101	27	298	25	305
ADE83099.1	1.18e-98	27	299	23	303
QVJ81211.1	1.18e-98	27	299	23	303
ALO49150.1	5.07e-98	27	298	24	304
QYR10545.1	1.24e-97	27	298	29	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	6.89e-14	33	161	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	8.30e-14	33	161	5	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	5.64e-13	33	161	5	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	6.64e-10	33	165	6	149	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	8.63e-10	33	165	6	149	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	7.33e-16	33	170	51	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9KQ15	1.98e-12	32	175	163	320	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P37710	2.20e-12	32	299	182	473	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9X9J3	1.87e-11	32	160	162	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9CIT4	4.21e-11	33	226	65	271	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000269	0.999066	0.000252	0.000151	0.000136	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003814_00405.