CAZyme Information: MGYG000003816_00164

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000003816_00164
• CAZy Family: GH88
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	MGYG000003816_6|CGC1	46717.79	6.0067

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003816	2849186	MAG	United States	North America

• Gene Location: Start: 7852; End: 9102 Strand: -

Full Sequence      

MNFHKKLMMLLLPAGLAAALPSCTSASADNSVDNSLAYCDRQIDRSIHNLTASGSTDYSM
QPRNIAPGDTAWACRPACAEEWCSGFWPGILWYDYENTGRKDIAEQADRYTRSLKPIVEA
PVFDHDLGFLIFCSYGNGYRLTHNPEYKEVILHAADSLATLFNPAVGTICSWPRNVEMLG
GHNTIMDNMINLEMLFWAAKNGGNPYLYDIAVKHAETTMAHQFRPDYTSYHIAVYNPVNG
DFIKGCTHQGNADDSMWARGQAWAIYGYTMVYRETKDPRFLDFAQKVTDVYLSRLPADRI
PYWDFDVPQADPTPRDVSAACVVASALIELSSYVDEEKGAGYMAEAGKMLTSLKEDKYRS
NGKNCSFLMHSTGHHPAGSEIDYSIIYADYYYIEALTRLKHMEKVKPKLVALSKNN

Enzyme Prediction     

No EC number prediction in MGYG000003816_00164.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	80	399	1.8e-122	0.9787234042553191

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	6.48e-17	75	398	22	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU00175.1	6.12e-192	14	404	8	400
QUT34123.1	8.69e-192	14	404	8	400
QCD37075.1	7.83e-191	19	403	3	392
ALA72154.1	6.45e-190	20	407	15	403
QEW35632.1	6.45e-190	20	407	15	403

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	1.46e-91	60	410	54	399	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
1VD5_A	3.25e-58	81	400	41	365	CrystalStructure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	1.77e-57	81	400	41	365	ChainA, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	9.15e-48	81	398	67	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	9.36e-48	81	398	68	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	7.12e-79	79	402	74	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q9RC92	1.78e-57	81	400	41	365	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q9A0T3	5.87e-52	81	398	69	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8DR77	1.65e-49	81	398	66	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q8E372	5.12e-47	81	398	68	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000126	0.128788	0.870901	0.000079	0.000058	0.000047

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003816_00164.