CAZyme Information: MGYG000003816_01665

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000003816_01665
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484		54008.14	4.8206

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003816	2849186	MAG	United States	North America

• Gene Location: Start: 359; End: 1813 Strand: -

Full Sequence      

MTRLRHTLAIAALGVSMVACGSDNPDNGGNGQTPDPGKPSTELSASRNLRRSIEIIDAAI
GNYMEGDGMKMARYYNPYTEQRSDETGSVWMYTSSIEAVNAAMRAMEALKGKGDASLYDA
NFARYKELLSKLYAGMEYYKGTFTHTSYTQTREWDVYGVNRGRDKGAAEVSGVLNVYDDQ
MWIIRELLESYRTTGIQDYLGKAEYLAEYVLDGWDCTLDADGNQNGGITWGPGYATKHSC
SNGPLISPLVWLSEIYKGKDDKITCRYIDSDSRRCEKTMDKAGYYLDFAKAVYDWQKRNL
LVPSTGVYDDFMGGGPDIAYETVDGVRYRAHSPKPDRVGPAYSYNSGTMISGAADLYAAT
GDPVYLEDLKALSDKSFATFAKEGVSHKGFYEFDLNGFNTWFNGVLMRSYHEALPYNPGN
AAYLKAFQDNLDYAYDNFLYGGMLPTSLLGGWNRDRQRNNTEGMFEFTFGAEYAVLAINQ
LNKN

Enzyme Prediction     

No EC number prediction in MGYG000003816_01665.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	71	437	1.2e-45	0.7960893854748603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	1.72e-17	177	408	86	286	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	7.48e-08	177	362	92	227	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT62205.1	9.28e-205	1	483	1	484
QQA30660.1	9.28e-205	1	483	1	484
QUT64972.1	7.13e-201	15	483	13	480
BBK85776.1	7.93e-201	15	483	16	483
QPH58159.1	7.93e-201	15	483	16	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	1.79e-17	177	438	117	327	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
6SHD_A	5.82e-13	175	453	131	364	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	4.37e-12	175	453	132	365	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	1.38e-11	182	453	140	365	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4C1S_A	1.69e-10	177	442	107	334	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000039	1.000027	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003816_01665.