CAZyme Information: MGYG000003816_02037

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000003816_02037
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790	MGYG000003816_219|CGC1	88624.84	6.1721

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003816	2849186	MAG	United States	North America

• Gene Location: Start: 1596; End: 3968 Strand: +

Full Sequence      

MNRSCRAAVALAAATLFFPGISTAEKVRMFPLSDVKLLDSQFKRGDDLNVEVLLKYDVDR
LLAPYLKEAGLQPKAQSYSNWDGLDGHVGGHYLSALALAYASTGNEECKRRADYMVDELK
RCHDANGNGYVGGVPGSKEMWEKVKNGDGGAVASRWVPWYNVHKMYAGLLDAWKHTGNED
ARKLFLDFCDWGIDVISGLDNIQMEKMLDTEFGGMNESYADAYELTGDSKYLEAAKRFSH
KRIFDNMAHRTDNLDNMHANTQVPKAVGYQRVAELTGDPAYTTAGEFFWETVTGNRSLSI
GGNSRREHFPSAKGCVEYTEEREGPESCNTYNMLKLTEGLFRMQPQGKYADFYERALYNH
IRSTQHPGHGGYVYFTSARPRHYRVYSQPNQAMWCCVGTGMENHGKYGEFIYAHGEDDVY
VNLFIPSKLDWKDKGISLTQTTQFPEQESTRLSITVKKPKTFTLKIRRPGWLADAPSVKI
NGKAVANLNVGDDSYISITRKWKNGDVVEMEMPMAAHIEKMPNVPDFISVIYGPVVLASR
HGSEDLAGLVADDGRWSHIAHGTLLPLSGAPVITGTEAQIAEKLSRMTPVDGKPLHFTVP
GLFAQKEYASLELEPFAGIHDSRYSFYWQSMTDEDYTANLKKREEDEKARLELDRRTVDL
VILGEQQPEADHRMKEKNTFKGNAHDESFRGINKDGFLSLEMAPSGNHNLTVDLRVWGDE
QGDCGLTVSVEGIEIGKENLSGKWNEKAFRNLTFALPEELVEGKDNITLTIAPISGNRIP
GIYEVRLLRK

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	34	538	1.5e-206	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	34	538	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.64e-127	19	604	1	572	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	6.69e-36	542	628	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36520.1	0.0	30	789	31	786
SCV06553.1	0.0	29	790	31	798
QRQ58640.1	0.0	29	790	31	798
ALJ47143.1	0.0	29	790	31	798
QUT25628.1	0.0	29	790	31	798

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	3.81e-224	23	789	21	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	4.56e-217	23	789	21	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	1.07e-26	138	540	129	547	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.53e-22	92	582	82	605	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.51e-21	92	582	82	605	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.01e-07	87	540	145	568	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000245	0.999043	0.000206	0.000171	0.000159	0.000134

TMHMM  Annotations     

start	end
7	24