CAZyme Information: MGYG000003817_00226

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; 51-20
• CAZyme ID: MGYG000003817_00226
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	MGYG000003817_20|CGC1	39037.45	8.7907

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003817	1298123	MAG	United States	North America

• Gene Location: Start: 2199; End: 3212 Strand: +

Full Sequence      

MQIPKIIHYFYDDVNPWTKGKNPQFRMCLYSWKKACPDYALMLWHEKSPEFGQILQQSLF
VRKAYELKLWAFVSDYVRLYALNKYGGIYLDTDVQLLQNFDKFLDDGFFVSVESDIHGQE
NVPEPAVMGSTPGHPLIAGTMKLYQSEQVFEIEKPMIPLVMKKALAELSGFARVPYDSSQ
LALRAEGYYLNNRRIDDYEVYLGQQCYRDDRRQISVYPCRRFCPSWCVFGEQAVTPETVA
IHWNQSSWWQADAFVRLHNSILPPPPPPPPPAPVPPSLPPRRYLSYGLFKLPLLKICHMP
PKTKVSCLGLLIVCRSPRYFKLSLLGALTLFKIVRRD

Enzyme Prediction     

No EC number prediction in MGYG000003817_00226.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	25	105	4.9e-20	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	5.59e-16	3	135	82	205	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	5.36e-13	27	106	5	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	0.001	71	144	111	188	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.002	37	93	146	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHI12494.1	4.60e-32	2	248	3	212
QFG50534.1	4.60e-32	2	248	3	212
AYJ41438.1	8.13e-31	3	146	2	133
ARW74840.1	2.41e-30	2	248	5	215
ARW77199.1	2.41e-30	2	248	5	215

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003817_00226.