CAZyme Information: MGYG000003817_01232

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; 51-20
• CAZyme ID: MGYG000003817_01232
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	MGYG000003817_247|CGC1	43464.97	9.9146

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003817	1298123	MAG	United States	North America

• Gene Location: Start: 956; End: 2128 Strand: -

Full Sequence      

MNNNLKIYLIAGEPSGDALGARLMRAIKKKTGGKAEFFGIGGDTMEKEGMSSLFDISELA
IMGLCEVIPSIPRVLKRIGQTVDDIVRIRPDVVISIDSWSFGSRVQKKLRALKTGIPQIH
YVAPQVWAWKKKRARTMYKYVDHLLTLLPQEPKYFTPYGLPTTFVGHPVIESPVVHGDRE
IFRRKYSIDAAQKIICLLPGSRHNEVSRLLPIFLEAAQMLKQQHPELFFVIPTVKTVAAR
VKNMLKNNPLPVLVVEGEEDRHNAMSAAAAAIAASGTVALELAIADVPHVIGYKVAPVTA
ALVKHFLHIQFVNLSNILLGREIVPELLQERCVASNIVLYINRFLEQDSFYRHQAEGFKK
VREVLGLGEQTPSEKAADVILQIIADTRKV

Enzyme Prediction     

No EC number prediction in MGYG000003817_01232.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	7	365	8.4e-122	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.53e-140	4	384	1	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.56e-138	5	384	2	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.49e-98	7	380	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.12e-80	7	383	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.80e-47	6	383	3	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10250.1	7.10e-206	1	384	1	384
ANC91241.1	2.65e-121	7	390	13	396
QCO07655.1	7.90e-120	7	385	6	384
QEL96223.1	7.90e-120	7	385	6	384
ALJ35067.1	7.90e-120	7	385	6	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.37e-59	5	383	7	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.37e-59	5	383	7	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
7TGH_T1	2.62e-09	7	291	18	375	ChainT1, Lipid-A-disaccharide synthase [Tetrahymena thermophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6IST7	9.20e-116	5	384	4	383	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
Q2W4D7	5.19e-115	7	384	3	381	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
Q3SRI5	5.76e-88	2	388	8	393	Lipid-A-disaccharide synthase OS=Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255) OX=323098 GN=lpxB PE=3 SV=1
Q5FUA3	7.17e-88	7	384	31	405	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
Q1QMM4	9.11e-84	2	388	8	393	Lipid-A-disaccharide synthase OS=Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14) OX=323097 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003817_01232.