CAZyme Information: MGYG000003819_00535

Basic Information

• Species: UMGS1872 sp900555795
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UMGS1872; UMGS1872 sp900555795
• CAZyme ID: MGYG000003819_00535
• CAZy Family: GT2
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299		32663.8	7.9956

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003819	2286303	MAG	United States	North America

• Gene Location: Start: 53387; End: 54286 Strand: -

Full Sequence      

MADYFSLFYVLVISSIYLIQLISAAIGLRKYSRSLKYTDYQRFRESHNMVPISVLVPACN
EAATIADNTRNLLSLDFPQYEVIVINDGSRDETMEILKESFKLVPIHIPFKRSLPTKEIR
TVYRSAMYPNLVVLDKENGGKADALNAGMNASMYPVFISIDADSILEKSSLIKIVYAFMS
DPACVAVGGIVRIGSGCKIVDGELREVDLADKPLLLLQTNEYLRAFLTGRIGFNQMGMLL
IISGAFGAFNKRAVIDVGATPPAASAWCACPTSGSLSSSAPSSRSWAMWRSPSPSSSGS

Enzyme Prediction     

No EC number prediction in MGYG000003819_00535.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	53	205	1.2e-21	0.7647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	1.49e-52	54	259	1	171	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.29e-28	4	258	13	230	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	1.02e-27	51	258	55	225	N-glycosyltransferase; Provisional
cd06439	CESA_like_1	1.13e-21	51	203	30	158	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
pfam00535	Glycos_transf_2	6.71e-21	53	246	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAA31055.1	4.61e-86	3	258	13	268
AEM79726.1	2.35e-85	3	258	17	272
QAA34471.1	4.13e-84	5	258	16	269
ABW18174.1	5.29e-82	7	262	18	273
AJA51554.1	7.44e-82	3	258	15	270

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	7.47e-07	52	180	15	118	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6GDD8	1.36e-16	52	258	49	217	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q9RQP9	1.36e-16	52	258	49	217	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q99QX3	1.36e-16	52	258	49	217	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1
Q7A351	1.36e-16	52	258	49	217	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q5HCN1	1.36e-16	52	258	49	217	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27