CAZyme Information: MGYG000003820_01778

Basic Information

• Species: UBA5446 sp900543085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA5446; UBA5446 sp900543085
• CAZyme ID: MGYG000003820_01778
• CAZy Family: GT84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2321	MGYG000003820_56|CGC1	248394.88	7.4532

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003820	2418429	MAG	United States	North America

• Gene Location: Start: 6494; End: 13459 Strand: -

Full Sequence      

MKNGEKAQDSKRIELEEYGAAEAERLCAAGYFSGKREARRIRALLHELSGVKAETLGAAG
EWLADNRYLIEREALAAARDFAAVKRVRAGRVNSLAAEAGASLAARVDGAVTLSSAEAYF
AGFRRVNALTLGELALLGASLRAGLAELIASEFSSRAPDVRRVSAAIESLRALSTADMVS
LVESADAAGAILSRDPAGAYAGMDERTRAGYRRRLARLAARADISESECARRVLTLAEEH
RDEPKRGHVGWWLFCEPLGRPGKRNEGRLYALTVCALAIGVSLAAGAIAGGAWAALLALL
PASELVKNALDAALLRALPVRSVPRMELAHGVPGEGRSICVVSAILAKPEDGKALARRLE
EFRLASRDCGGELRFGLLADLPEAKSGKTAADAAAIEAARRAIDGLNGKYSGGFYLFLRE
RREARRDGVWRAHERKRGALLALAGLCAGRESELEVLSGDAAALAGTRYIITLDADTRVL
PGSARELIGAMLHPLNRAELGENGSVVSGRGVIHPRIGVELAASEATHFARAVAGPGGVD
PYGSACGEVWMNLTGRGGFAGKGILDVDALLACCSDLPENLVLSHDAVEGALLHGGYMGD
TVLTDGFPSAPAAYFKRQHRWVRGDWQNLAVLLRLWSRFAAADRLKLLDSVRRSLVPVAT
APAIALAALLPGLYTAGTVAALSLCSGLAGAVARSLTRRSGRERHPGGALYGAALRVGQV
VLRLLFLPWEAWVDLSAACTALWRMLISRRRLLQWQTSAQCGSGGALSTVRAAWPCIALG
LALLILSPYPAGKALGIVWLAAPVFALSLGRECGREALPAAGERRFLMDECAKIWAYFDE
FCTAGRGYLPPDNWQEQPPVGVAERTSPTNIGLGMVSALAALDLGLTTLDRAAEIVGGML
DTCERLDKWRGHLYNWYDTRTLKPLSPAYVSTVDSGNLAASLTALAAGLREYGCHELAGR
ASALAQGMDFAALYDRRRRLFRIGYDAAQDALSEGCYDLMASEARLTGYYAVASGAVSAR
HWRQLSRALVSRDGYRGLASWTGTMFEYLMPELFLPLQRGSLLWESARFCLYVQRRDVPE
GAPWGQSESAFFSLDAALAYRYKAHGCAALALQRGMGTDTVCAPYAAYLALAVAPHAAVR
DLVRFAGIDGGGRFGLWEAVDFTPRRCGEDGEVVRCVMAHHLGMSLISAANYLAGGAIVR
RFMSDAAMAAYAPLLGERVPEGAVLLRRRAYRPPERERGRERCVISASGECLPTAEPRVF
TLSNGVYSLHCTDDGRSRSCAGAVALYRGFAPDAAGAAGLRLSLHTAGESVSLLPSGRSD
GLKFTYRLRGGVLRFDGEGGGLECSVTAGVSARDLGEIRVVEIKPRAALSGELRLEFEPA
LAREADWDAHPAYWRLGLTAKVRDGALLLRRLPRSGLDGCWLCLAADAGAELRANIDGEP
LGALSHPYVTARVPLELKAGATARVRFALAFAAGEDEAFASAQRTLHAGAAQLADLASAL
GAVYGLAPEYLDAIPALAGRLSFPRAISDDPPAKEELWAAGISGDFPIVAARAGEGDAAL
IASLAARHALMRMCGVKADLVFLTSDGGDYHRRTSRAVSRALAAAGLDSLLGSRGGIHCA
DADMAALVERSAAVLLDGAAPPERAALPETAGEPAAVPGELRRGGSVDCEWTDGAFAFTV
RGALPRRAWCLPMSNGRFGYLAADCGLGCMWTDNARERRVNAWVCDERASHGPETLETRA
NGAPVSLFAAEDGAECRVTYGLGWASWEKLGARLTAFVPPETAARVLIIENPPGEVRWRT
QLQLSAEARDACFTVTRLEDGALRAVNARGGMELSAVFSHSVRAAGVGSAAFDVTLPRAG
TLVIVCGTAEARALRALAEPDEARRALERTRAHYAEICARIRVESPYAEVNRYVNGWAVY
QAYVCRMLARTSLYQSGGAFGFRDQLQDAVNLLCVDPALARARILDACAHQYAEGDVMHW
WHRGAPDKGVRTRISDDLVWLPWAVCEYLDATRDETLLAERVAGIDSEPLRPDEESRYED
ARPGAEKSVLEHAAAALRCVLRRGFGAHGLLLMGAGDWCDGFDAVGRAGRGESVWLTEFF
AHTARRFALLLESRGDTPSAAVLQSAARRCIKGVEDAWDGAWYRRGYFDDGVPLGSAKSG
ACKIDAIAQAWAAFAGCDGERVKTALRSAAARLFDRETGVVKLFDPPFSESTEHAGYVNS
YGEGFRENGGQYTHGAIWLALACLEHGLRREGEEMLLALLKRGGNYGAEPFVLAADVYSN
PYRAGEAGWTWYTGSAGWYLRAALSAWGEPKGEVETKFKEN

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	1853	2304	1.4e-143	0.4333976833976834
GT84	996	1205	5.3e-66	0.986046511627907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	8.78e-117	1537	2305	132	977	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	7.31e-76	1893	2304	1	418	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
cd11753	GH94N_ChvB_NdvB_2_like	4.66e-14	1198	1484	1	323	Second GH94N domain of cyclic beta 1-2 glucan synthetase and similar domains. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes cyclic beta 1-2 glucan synthetase (EC:2.4.1.20) or ChvB (encoded by the chromosomal chvB virulence gene). This second of two tandemly repeated GH94-N-terminal-like domains has not been characterized functionally. Some beta 1-2 glucan synthetases are annotated as NdvB (nodule development B) gene products, glycosyltransferases required for the synthesis of cyclic beta-(1,2)-glucans, which play a role in interactions between bacteria and plants.
pfam10091	Glycoamylase	5.79e-11	997	1204	3	213	Putative glucoamylase. The structure of UniProt:Q5LIB7 has an alpha/alpha toroid fold and is similar structurally to a number of glucoamylases. Most of these structural homologs are glucoamylases, involved in breaking down complex sugars (e.g. starch). The biologically relevant state is likely to be monomeric. The putative active site is located at the centre of the toroid with a well defined large cavity.
cd11756	GH94N_ChvB_NdvB_1_like	1.81e-05	1689	1862	32	224	First GH94N domain of cyclic beta 1-2 glucan synthetase and similar domains. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes cyclic beta 1-2 glucan synthetase (EC:2.4.1.20) or ChvB (encoded by the chromosomal chvB virulence gene). This first of two tandemly repeated GH94-N-terminal-like domains has not been characterized functionally. Some beta 1-2 glucan synthetases are annotated as NdvB (nodule development B) gene products, glycosyltransferases required for the synthesis of cyclic beta-(1,2)-glucans, which play a role in interactions between bacteria and plants.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBB66089.1	0.0	15	2304	14	2324
ALP93881.1	0.0	15	2064	14	2084
CDZ23197.1	0.0	59	2304	63	2426
AVQ95160.1	0.0	14	2304	25	2479
AYF37850.1	0.0	14	2304	25	2479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZLE_A	6.37e-27	1901	2314	312	719	Cellobionicacid phosphorylase - ligand free structure [Saccharophagus degradans 2-40],4ZLF_A Cellobionic acid phosphorylase - cellobionic acid complex [Saccharophagus degradans 2-40],4ZLG_A Cellobionic acid phosphorylase - gluconic acid complex [Saccharophagus degradans 2-40],4ZLI_A Cellobionic acid phosphorylase - 3-O-beta-D-glucopyranosyl-alpha-D-glucopyranuronic acid complex [Saccharophagus degradans 2-40]
2CQS_A	7.10e-27	1886	2298	327	756	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]
3AFJ_A	2.13e-26	1886	2298	327	756	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127],3AFJ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127]
3ACT_A	4.84e-26	1886	2298	327	756	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127],3ACT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127]
3ACS_A	1.10e-25	1886	2298	327	756	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase W488F mutant [Cellulomonas gilvus ATCC 13127],3ACS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase W488F mutant [Cellulomonas gilvus ATCC 13127]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20471	1.08e-225	296	2304	447	2764	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
B9K7M6	7.72e-28	1881	2298	296	725	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q7S0S2	1.23e-24	1888	2304	302	712	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1
Q8P3J4	3.54e-21	1901	2304	325	717	Cellobionic acid phosphorylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC4077 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
269	291