CAZyme Information: MGYG000003822_00697

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A
• CAZyme ID: MGYG000003822_00697
• CAZy Family: GH65
• CAZyme Description: Alpha,alpha-trehalose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
501	MGYG000003822_64|CGC1	58468.6	5.6999

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003822	2177729	MAG	United States	North America

• Gene Location: Start: 302; End: 1807 Strand: +

Full Sequence      

MEKQELEPFVRALLAQTAQEGFKELADFQKRYMKRYWEIADVVLEGQNALQQGIRFNLFH
IMQAAGRDGNTGMGAKGLSGEGYEGHYFWDTEMYVLPVLIYTEPEAARKLLEYRYHTLNQ
ARARARILGHDKGALFPWRTINGEEASTYYPLGTAQYHINADIAYALSLYLKVTGDVVFF
KEMGAELLIDTARIWADVGSFAECRDGKYCICCVTGPDEYNVLVDNNFYTNLMAREHLKD
ALQTVKYLQEKDRGCLERLMKKLDFEMQETELWEKIIENMYFPYDEEHRIYPMDDGFMMR
KPWDESRIPPEKRAWLYENYHPLFIMRHRMSKQADAILGMYNHCQLFTPEELRRNYDFYQ
EVTLHHSSLSTCIFGIVACKIGYYEEACRYFMQSARMDLDDYHNNFYAGIHAANMAGTWQ
AIVNGFAGLYLKDGYLHFKPYLPDGWEGYAFHLRVRDCVLGVRIHGHEAVFTLCEGSNLV
FYVKDKEIRLNEQGGSCIENI

Enzyme Prediction     

EC	2.4.1.64

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	55	433	1.3e-140	0.9946236559139785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	1.05e-170	6	500	270	770	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
PRK13807	PRK13807	2.69e-145	2	490	268	748	maltose phosphorylase; Provisional
pfam03632	Glyco_hydro_65m	2.43e-133	55	436	1	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
pfam03633	Glyco_hydro_65C	6.86e-12	440	489	1	50	Glycosyl hydrolase family 65, C-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The C-terminal domain forms a two layered jelly roll motif. This domain is situated at the base of the catalytic domain, however its function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY99093.1	2.11e-278	1	501	285	785
QRO38179.1	1.33e-271	1	501	281	783
QBF74991.1	1.33e-271	1	501	281	783
QIB55917.1	2.19e-269	1	501	279	779
QMW76215.1	2.19e-269	1	501	279	779

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H54_A	4.46e-96	17	483	285	743	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
3WIQ_A	1.03e-90	34	464	287	729	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	7.10e-74	8	472	252	732	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	1.91e-73	8	472	252	732	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
7FE3_A	2.10e-35	17	447	269	660	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L164	2.18e-156	20	492	300	770	Alpha,alpha-trehalose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=treP PE=1 SV=1
Q8GRC3	2.94e-145	22	492	285	751	Alpha,alpha-trehalose phosphorylase OS=Geobacillus stearothermophilus OX=1422 GN=treP PE=1 SV=1
O06993	4.23e-98	3	490	267	746	Maltose phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=mdxK PE=3 SV=1
P9WN13	3.27e-96	21	476	293	734	Uncharacterized glycosyl hydrolase Rv3401 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3401 PE=1 SV=1
P9WN12	3.27e-96	21	476	293	734	Uncharacterized glycosyl hydrolase MT3509 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3509 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003822_00697.