CAZyme Information: MGYG000003822_01010

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A
• CAZyme ID: MGYG000003822_01010
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
809		94170.45	5.6532

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003822	2177729	MAG	United States	North America

• Gene Location: Start: 1625; End: 4054 Strand: +

Full Sequence      

MRYAPKRNVNLGFSDYYDGRKGNLKWIADSREAGDWGYGKVLPRKGEQTEKKSRPIRMLH
STEVYPKKVECIQDVKRGCQQLTLNTRRAFFGDRRDANETIFSGFLGGCFTAEKDMEGMI
SFPNRTWNGIIGTFRLGGKVYPVDNAHRDIPVQIPAGQQFFLMQISGKFDDLYCHIELRF
PEKLKTGGFFTVGPTQRICQKLDGVSRIYGGLDEFNEMESYTKKHRRIFEAQSLEELQKL
TDEIVFLDEKDIFEDMYLLSLARTEEVVQEYAVTTEDCGILWKNQSCTAIGLPQAGDYRR
ILVDFGNICVGQLSFTLKAAEGTTIDIYGFENYYRREIDFTIGLNNGIRYVTSEGWQTYE
CMVRTGMRYALITVRNAKKPVLIRDFHMRHETYALSSMGQFESSDTLLNRIFEMCRDTNR
FCTEDCFTDSPTYEQAFWTGDAQLSSLINGWLFGDYEYAVHVQKLAVTAQNNTMMMNALT
PTDWDTSIPMWMMNWVLSVFETEELSGSREHIETLYPYIYRVLEFYRQFITEDGGFLINA
WNMIDWAAMDIGNHGVVTAHQAQLAYCYRIVGKYCEETGRTAEGKKFLEADEALLAYIDR
FMWDKDRRMYLDGWSPEKGNSSTVSIQTHIMLYLYDGIMGEDKKELVKQYLLNPPAEFLK
VGSPFMLYYLYQAYGKAGKRDLIFPDIKKRWGEMLKYDSTTCWEVFPGFYENGRTRSYCH
SWSASPAFFMLRYLSGIRILEEGFRKITFETCPIELQWCRSSIPTPYGMISIDWYKENGV
YDVRMEVPEQIEFVPCKEEKVRIQIKYLK

Enzyme Prediction     

No EC number prediction in MGYG000003822_01010.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	300	792	5.8e-89	0.9742063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.32e-33	399	734	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.58e-07	736	789	1	55	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK57954.1	4.73e-169	2	785	139	934
AEE96402.1	5.39e-150	2	789	138	923
QGQ94343.1	1.81e-117	4	792	145	947
ALS26629.1	4.10e-115	4	792	143	938
QJD85544.1	2.19e-113	4	787	142	940

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.06e-104	4	808	141	955	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	1.84e-29	368	784	274	684	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	6.31e-18	403	733	211	541	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
6I60_A	2.59e-14	293	792	359	893	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.43e-06	302	792	385	901	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003822_01010.