CAZyme Information: MGYG000003824_00472

Basic Information

• Species: CAG-110 sp900549495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900549495
• CAZyme ID: MGYG000003824_00472
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase A and B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301	MGYG000003824_8|CGC1	34332.34	4.6439

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003824	2193767	MAG	United States	North America

• Gene Location: Start: 10589; End: 11494 Strand: -

Full Sequence      

MAAYALSNPNADETTKSVYKYLCSLKGETTLSAQQESTWMGSADYEMDYIYAHTGKLPAM
RGLDYMHDDFAGVNKRAAQWWQQGGLVTICWHTGADFTGEWKDCMESELGDWDAVLTPGT
AENEAFLAGMDKAGRALLELQEQGVTVLWRPFHEFDGKWFWWGKGGPENFCKLWRMMYTH
YTQDLGLNNLIWVLGYSHLYQGYSGWYPGDEYVDVIGADSYQGGAQNKLYQALRKITLSK
PFAFHECGTNPTAQELATTPWAWFMTWHTSFVTEENTPEDYHALYNSPQVITREGLPRFQ
G

Enzyme Prediction     

No EC number prediction in MGYG000003824_00472.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	7	294	3.7e-85	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.50e-43	8	294	2	310	Glycosyl hydrolase family 26.
COG4124	ManB2	1.39e-17	120	289	154	343	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU20874.1	9.57e-104	5	297	166	460
BCN30282.1	1.03e-99	6	299	6	299
AJP70762.1	3.42e-75	5	298	21	324
ATC26721.1	3.09e-69	6	296	1	294
QQQ74226.1	3.04e-68	8	300	175	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HF2_A	9.30e-52	6	300	45	360	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	6.53e-50	8	296	25	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3WDQ_A	2.14e-45	25	297	59	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6D2X_A	2.60e-41	6	296	4	334	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
3ZM8_A	1.30e-40	6	296	145	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	2.91e-41	5	300	173	480	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P16699	6.28e-39	5	248	33	297	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1
P49425	1.29e-35	6	297	146	458	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
Q5AWB7	1.04e-33	8	296	30	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55298	4.53e-30	6	299	156	462	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003824_00472.