CAZyme Information: MGYG000003824_00474

Basic Information

• Species: CAG-110 sp900549495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900549495
• CAZyme ID: MGYG000003824_00474
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000003824_8|CGC1	40234.59	5.0839

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003824	2193767	MAG	United States	North America

• Gene Location: Start: 12697; End: 13770 Strand: -

Full Sequence      

MSVLFSQRVDPDSPMLQYMGRIDDSNPNAPVLVYPCSCVKIRFWGSAIGMEITNLHSYYE
NSLGILLDGEQRKIVLPEKGRDFIPIAQDLPEGEHTLTLFKRMDGCHYVIFHGFLLPGNA
RLLPLPQKPKRRMEFYGDSVTAGEVSELVDCCGMADPAHNGEYSNSFYSYAWCTARRLNA
QIHNIAQGGIALLSGTGYYCAPQLIGMEQMYDKIQCNPNLSPTEPWDFSRYTPHVVVVAI
GQNDSHPEDFMEPGLDNPKAQSWMARYAAFIGRLRQCYPKATILLTTTILNHNANWDRAI
DAVCQRLGDAKIHHFLYSNNGCGTPGHIRRPEAEQMAEELSAFVETLGEDIWEDEYD

Enzyme Prediction     

No EC number prediction in MGYG000003824_00474.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	132	344	6.1e-58	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17996	CE2_N	2.15e-33	18	126	1	108	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
cd01831	Endoglucanase_E_like	1.31e-15	132	345	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam13472	Lipase_GDSL_2	1.27e-05	135	316	1	145	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd01833	XynB_like	2.30e-05	229	303	37	102	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
cd00229	SGNH_hydrolase	2.59e-04	135	320	3	155	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL10431.1	5.90e-147	9	353	3	348
CBL12376.1	1.02e-146	9	353	39	384
VCV21230.1	1.12e-144	9	353	3	348
AEN97395.1	1.30e-141	7	353	3	350
BBF42855.1	4.84e-133	7	354	392	739

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	7.41e-31	10	346	5	329	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	1.98e-30	10	346	5	329	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAA_A	1.38e-19	14	341	18	330	Structureof a family two carbohydrate esterase from Cellvibrio japonicus [Cellvibrio japonicus]
3U37_A	1.20e-13	1	347	33	400	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]
4DEV_A	1.61e-13	1	319	33	372	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	1.60e-29	6	346	482	810	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PIB0	8.49e-19	14	341	37	349	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=axe2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003824_00474.