CAZyme Information: MGYG000003824_00848

Basic Information

• Species: CAG-110 sp900549495
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900549495
• CAZyme ID: MGYG000003824_00848
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000003824_20|CGC1	42502.31	5.7302

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003824	2193767	MAG	United States	North America

• Gene Location: Start: 3446; End: 4570 Strand: +

Full Sequence      

MYEEIDSYLHRLIAQSGPDYTAWNVERIRQGKSANWNYIDGCMMTALLAMAEITGKEEYF
SFVEGFLSSFVGEDGTIRTYDPTKYNLDDINEGRVLLPLYRATGKEKYLLAAGHLMEQLA
HQPRTQEGNFWHKRIYPNQVWLDGIYMAQVFYAQYQKQTGGSYRDILEQLATVRKRMFSP
EKQLYYHGYDAQRRAFWADPITGCSASFWLRSIGWFSVALADLLEILPAPEARPLAEMFR
ELMAGIAGYQEVETGMYYQVPDQGSRPGNYLETSGSSMVAYAMLKGARLGFLPKEYAAKG
AKTFDGIVRTKLHFDGESMNLEGICLVAGLGPEDNRRRNGTFEYYISEPVVSNDAKGVAP
FLLCYTEIKRLTPA

Enzyme Prediction     

No EC number prediction in MGYG000003824_00848.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	30	369	4e-104	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	7.22e-89	36	371	34	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	6.12e-80	25	371	16	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
cd04791	LanC_SerThrkinase	0.001	45	293	93	326	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SIP63207.1	4.97e-176	1	373	1	375
QTE68952.1	3.58e-163	2	370	13	382
ADU22672.1	1.56e-156	1	370	6	378
QNM04125.1	2.38e-133	6	371	5	376
CCV66002.1	6.54e-133	5	370	4	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.03e-89	35	371	22	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.13e-64	21	371	23	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	8.97e-64	21	371	13	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	5.68e-09	181	370	209	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.16e-63	21	371	23	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.60e-42	184	367	39	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.60e-42	184	367	39	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003824_00848.