CAZyme Information: MGYG000003829_01123

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111
• CAZyme ID: MGYG000003829_01123
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		36726.33	9.3609

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003829	1973429	MAG	United States	North America

• Gene Location: Start: 13946; End: 14947 Strand: +

Full Sequence      

MEKKTRILAINFGGIGDEIFFLPTLISLKHEFKNSEITLALEPRSKGIKDLTDVIDELIP
VDVKSGGGKKYIELFRLLMSARCGKFDIVISSGGNKLISILLFLTGIKVRCGYDTGRLSR
MLLTYAAVLNKNQYACKMYHDLIRNLTRHNTELPKINVVQKEKFSNSVLIHPGVSKLSVE
KGCIKTIPAQTWAKVIDLLVAEGKKVMLVGGPDDKECIETILANVRTKNFDNLYGTTKNL
KELAVLISSADKFLCSDSAPLHVAVALGVKTYVIFGPTDDKALIPQSEKVIPIKANDKCE
LKPCLWARRQTTCEKLSCLKITASQIAAVVCGD

Enzyme Prediction     

No EC number prediction in MGYG000003829_01123.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	77	313	1.1e-34	0.9422222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.09e-43	6	328	1	273	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	1.15e-43	6	303	3	305	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.65e-20	75	316	2	246	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	2.15e-17	1	297	1	310	lipopolysaccharide core biosynthesis protein; Provisional
TIGR02195	heptsyl_trn_II	1.20e-14	6	329	1	328	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38411.1	2.00e-155	6	330	2	326
AFY67702.1	2.92e-49	6	295	2	299
BAI93916.1	2.72e-46	6	295	2	300
QNH55727.1	2.72e-46	6	295	2	300
AMW31030.1	2.72e-46	6	295	2	300

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	1.64e-12	16	301	5	302	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	6.27e-10	16	297	5	298	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003829_01123.