CAZyme Information: MGYG000003831_00373

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000003831_00373
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664	MGYG000003831_7|CGC1	74300.34	7.305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003831	3246644	MAG	United States	North America

• Gene Location: Start: 17769; End: 19763 Strand: -

Full Sequence      

MGLATAFAVCGSYAKAPSHGYPIDPVNFTSVKINDNFWGKRLEAARNVTVPLAFSKCEET
GRYENFIKATRPDKSYKVEGFPFDDTDVYKTIEGASYLMQTYPDPKMEAYIDSVLVIVAA
AQEPDGYLNTSFTMNPEHPHPWMQPGKRWEKVEDLSHEFYNLGHMVDGAVAHYQATGKSN
FLDIAKKYADCICREIGNNPGQIAKIPGHQIAEMALARLYLVTGDSKYLDQAKYFLDMRG
RTSHRSEYNQSHKPVTEQKEAVGHAVRATYMYAGMADIAALTGDTAYISAIDSIWDNIVN
KKYYITGGIGARHAGEAFGNNYELPNLEAYNETCAAIGNVYVNHRLFLLHGDSKYYDVLE
RTLYNGLIAGMSVDGGSFFYPNPLASEGGYERKPWFGCACCPSNLCRFIPSIPGYIYAVK
GNDVYVNLYMGNQAKLDVKGKKLSLTQSGDYTWNGNVAITIDENKAGEFALKLRIPGWAR
NLPVPGNLYSYVDNVKTDYTVRVNGKPVESKLDKGYLSINRKWKKGDRIELNFDMTPRIV
AADKKVKADRGRVAVERGPIVYCAEWPDNNFDIQKILLNPKTIFTVTSAEKMGGIKELKG
KVQLIDHNAEGNFEIKDKELTMIPYYSWAHRGQGQMSVWLPASPSATRPEIVETNIILNE
FEGK

Enzyme Prediction     

No EC number prediction in MGYG000003831_00373.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	31	563	4.1e-211	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	30	563	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.65e-180	25	642	11	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG2866	MpaA	0.003	61	164	132	246	Murein tripeptide amidase MpaA [Cell wall/membrane/envelope biogenesis].
cd04792	LanM-like	0.007	173	233	605	677	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36182.1	0.0	9	654	14	662
QJR57394.1	0.0	6	654	11	661
QJR78977.1	0.0	6	654	11	661
AII67308.1	0.0	6	654	11	661
QJR57810.1	0.0	6	654	11	661

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	0.0	18	647	2	630	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	8.99e-150	29	640	14	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.11e-144	29	640	14	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.79e-110	13	641	33	695	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	9.51e-110	67	639	57	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	5.21e-109	67	639	57	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.914656	0.083748	0.001240	0.000141	0.000080	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003831_00373.