CAZyme Information: MGYG000003831_00556

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000003831_00556
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	MGYG000003831_11|CGC1	47795.11	4.9131

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003831	3246644	MAG	United States	North America

• Gene Location: Start: 31363; End: 32637 Strand: +

Full Sequence      

MKRLVSLTLGMAVLLGLAAGGAGCSNKEKEARMQDQFVKVDGHDLIKPDGSKLYITGTNL
GNWLNPEGYMFGFQRMNAPRQINDVICKLVGPDKAAEFWTKFKDNYITKADIDYIASTGA
NTIRLPFHYKLFTDEDYMGLFSSQDGFTRVDSVVSWCKANNLYLILDMHDAPGGQTGDNI
DDSYGYPWLMESEKSQQQFCDIWTRIADRYKCEPTILGYELLNEPVATYFEADQDSLNAR
LVDVYKKGVEAIRKVDPDHIILIGAPQWNSNFGPLEGVDFGPQVMYTCHRYGGAPTPEAI
RSYIDFRNKSGLPMYMGEIGHNSDEWQADFVKTMKENNIGYTFWPYKKRDGSCMVGITMP
GEWEEILKFGEGAHATFAEIREAAPDRAKAQVALDKFIDSCRFDNCTPQMSYISSMGLNP
HPDK

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	93	348	2.8e-96	0.9844357976653697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	4.43e-37	102	344	20	266	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.53e-18	91	225	58	191	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
COG3934	COG3934	0.006	95	320	16	245	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89172.1	1.62e-201	4	418	2	414
ALJ59797.1	4.63e-201	4	418	2	414
ADV42635.1	7.06e-201	1	418	1	415
QUU01283.1	2.76e-200	1	418	1	415
QUT37277.1	3.78e-200	1	418	1	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	1.51e-27	104	350	26	319	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	3.92e-27	104	350	26	319	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3W0K_A	5.08e-14	109	347	25	294	CrystalStructure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus],3W0K_B Crystal Structure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus]
1BQC_A	7.07e-14	115	351	41	261	Beta-MannanaseFrom Thermomonospora Fusca [Thermobifida fusca],2MAN_A Mannotriose Complex Of Thermomonospora Fusca Beta-Mannanase [Thermobifida fusca],3MAN_A Mannohexaose Complex Of Thermomonospora Fusca Beta-mannanase [Thermobifida fusca]
3N9K_A	2.56e-12	42	277	2	243	F229A/E292SDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
W8QRE4	8.83e-36	37	358	3	349	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
P23340	3.18e-27	104	350	26	319	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
A3DJ77	3.18e-27	104	350	26	319	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P0C2S3	8.27e-27	104	350	26	319	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
Q5B5X8	7.30e-16	55	305	29	275	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000045	0.999998	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003831_00556.